BDGP Sequence Production Resources |
Search the DGRC for AT01047
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 10 |
Well: | 47 |
Vector: | pOTB7 |
Associated Gene/Transcript | Atg8b-RA |
Protein status: | AT01047.pep: gold |
Preliminary Size: | 526 |
Sequenced Size: | 609 |
Gene | Date | Evidence |
---|---|---|
CG12334 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12334 | 2002-06-11 | Blastp of sequenced clone |
CG12334 | 2003-01-01 | Sim4 clustering to Release 3 |
Atg8b | 2008-04-29 | Release 5.5 accounting |
Atg8b | 2008-08-15 | Release 5.9 accounting |
Atg8b | 2008-12-18 | 5.12 accounting |
609 bp (609 high quality bases) assembled on 2002-06-11
GenBank Submission: AY069026
> AT01047.complete CATACATAGTTCCCAGCAACTCAGGCCGGCAGCTACATAAGACCTTCGTA CCAAATCCAAAACGAAAACCCATTTTTCGCTCCGTTTCGATTCGAACCGT ATTCCAGTCCGCCCAGATGGATATGAACTACCAGTACAAGAAGGACCACT CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA CCGATGAGAACGTCTATGGACGGCAGTAGACGCGGGCTTGACTCGCGTAA TCGTTTTGGCGGTCGGTTGAGTTTCAATTGTCATTTTTTGCCATTGGCAC TACTCGCTCAATAAAGAATGACTGCTCCTAGCCAGCTAACCAAAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 13548782..13549372 | 591..1 | 2955 | 100 | Minus |
chrX | 22417052 | chrX | 10656967..10657165 | 411..213 | 470 | 82.4 | Minus |
chrX | 22417052 | chrX | 10659342..10659433 | 214..123 | 235 | 83.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 17724435..17725026 | 592..1 | 2960 | 100 | Minus |
X | 23542271 | X | 10765604..10765802 | 411..213 | 470 | 82.4 | Minus |
X | 23542271 | X | 10767979..10768070 | 214..123 | 235 | 83.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 17465266..17465857 | 592..1 | 2960 | 100 | Minus |
X | 23527363 | X | 10773702..10773900 | 411..213 | 470 | 82.4 | Minus |
X | 23527363 | X | 10776077..10776168 | 214..123 | 235 | 83.6 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 13548782..13549372 | 1..591 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 1..363 | 117..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 1..363 | 117..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 1..363 | 117..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 1..363 | 117..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 1..363 | 117..479 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 19..609 | 1..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 19..609 | 1..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 19..609 | 1..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 19..609 | 1..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg8b-RA | 19..609 | 1..591 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17724436..17725026 | 1..591 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17724436..17725026 | 1..591 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17724436..17725026 | 1..591 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 13550158..13550748 | 1..591 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 17465267..17465857 | 1..591 | 100 | Minus |
Translation from 2 to 478
> AT01047.hyp YIVPSNSGRQLHKTFVPNPKRKPIFRSVSIRTVFQSAQMDMNYQYKKDHS FDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQF YFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYT DENVYGRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Atg8b-PB | 120 | CG12334-PB | 1..120 | 39..158 | 641 | 100 | Plus |
Atg8b-PA | 120 | CG12334-PA | 1..120 | 39..158 | 641 | 100 | Plus |
Atg8a-PA | 121 | CG32672-PA | 1..116 | 41..156 | 530 | 82.8 | Plus |
Atg8a-PC | 107 | CG32672-PC | 7..102 | 61..156 | 401 | 78.1 | Plus |
Atg8a-PB | 96 | CG32672-PB | 6..91 | 71..156 | 395 | 84.9 | Plus |
Translation from 116 to 478
> AT01047.pep MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKK YLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEH FDKDYFLYISYTDENVYGRQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23138-PA | 122 | GF23138-PA | 1..118 | 1..118 | 576 | 92.4 | Plus |
Dana\GF20824-PA | 121 | GF20824-PA | 1..116 | 3..118 | 526 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16757-PA | 120 | GG16757-PA | 1..120 | 1..120 | 613 | 96.7 | Plus |
Dere\GG18902-PA | 121 | GG18902-PA | 1..116 | 3..118 | 525 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15861-PA | 125 | GH15861-PA | 1..120 | 1..120 | 528 | 80 | Plus |
Dgri\GH12106-PA | 119 | GH12106-PA | 1..116 | 3..118 | 525 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Atg8b-PB | 120 | CG12334-PB | 1..120 | 1..120 | 641 | 100 | Plus |
Atg8b-PA | 120 | CG12334-PA | 1..120 | 1..120 | 641 | 100 | Plus |
Atg8a-PA | 121 | CG32672-PA | 1..116 | 3..118 | 530 | 82.8 | Plus |
Atg8a-PC | 107 | CG32672-PC | 7..102 | 23..118 | 401 | 78.1 | Plus |
Atg8a-PB | 96 | CG32672-PB | 6..91 | 33..118 | 395 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23636-PA | 122 | GI23636-PA | 1..120 | 1..120 | 545 | 84.2 | Plus |
Dmoj\GI15162-PA | 119 | GI15162-PA | 1..118 | 3..120 | 526 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12240-PA | 116 | GL12240-PA | 1..116 | 1..116 | 534 | 86.2 | Plus |
Dper\GL26902-PA | 120 | GL26902-PA | 1..116 | 3..118 | 524 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11562-PA | 116 | GA11562-PA | 1..116 | 1..116 | 534 | 86.2 | Plus |
Dpse\GA23118-PA | 116 | GA23118-PA | 1..116 | 1..116 | 534 | 86.2 | Plus |
Dpse\GA22662-PA | 120 | GA22662-PA | 1..116 | 3..118 | 524 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15346-PA | 266 | GM15346-PA | 147..266 | 1..120 | 646 | 100 | Plus |
Dsec\GM11288-PA | 121 | GM11288-PA | 1..116 | 3..118 | 525 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20217-PA | 227 | GD20217-PA | 108..227 | 1..120 | 644 | 100 | Plus |
Dsim\GD16015-PA | 121 | GD16015-PA | 1..116 | 3..118 | 525 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24711-PA | 124 | GJ24711-PA | 1..120 | 1..120 | 539 | 83.3 | Plus |
Dvir\GJ14868-PA | 119 | GJ14868-PA | 1..116 | 3..118 | 525 | 82.8 | Plus |