Clone AT01047 Report

Search the DGRC for AT01047

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:10
Well:47
Vector:pOTB7
Associated Gene/TranscriptAtg8b-RA
Protein status:AT01047.pep: gold
Preliminary Size:526
Sequenced Size:609

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12334 2002-01-01 Sim4 clustering to Release 2
CG12334 2002-06-11 Blastp of sequenced clone
CG12334 2003-01-01 Sim4 clustering to Release 3
Atg8b 2008-04-29 Release 5.5 accounting
Atg8b 2008-08-15 Release 5.9 accounting
Atg8b 2008-12-18 5.12 accounting

Clone Sequence Records

AT01047.complete Sequence

609 bp (609 high quality bases) assembled on 2002-06-11

GenBank Submission: AY069026

> AT01047.complete
CATACATAGTTCCCAGCAACTCAGGCCGGCAGCTACATAAGACCTTCGTA
CCAAATCCAAAACGAAAACCCATTTTTCGCTCCGTTTCGATTCGAACCGT
ATTCCAGTCCGCCCAGATGGATATGAACTACCAGTACAAGAAGGACCACT
CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG
GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA
GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT
TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC
TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC
ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA
CCGATGAGAACGTCTATGGACGGCAGTAGACGCGGGCTTGACTCGCGTAA
TCGTTTTGGCGGTCGGTTGAGTTTCAATTGTCATTTTTTGCCATTGGCAC
TACTCGCTCAATAAAGAATGACTGCTCCTAGCCAGCTAACCAAAAAAAAA
AAAAAAAAA

AT01047.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RA 621 Atg8b-RA 19..610 1..592 2960 100 Plus
Atg8a-RA 1421 Atg8a-RA 398..735 123..460 775 81.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13548782..13549372 591..1 2955 100 Minus
chrX 22417052 chrX 10656967..10657165 411..213 470 82.4 Minus
chrX 22417052 chrX 10659342..10659433 214..123 235 83.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:36:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724435..17725026 592..1 2960 100 Minus
X 23542271 X 10765604..10765802 411..213 470 82.4 Minus
X 23542271 X 10767979..10768070 214..123 235 83.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17465266..17465857 592..1 2960 100 Minus
X 23527363 X 10773702..10773900 411..213 470 82.4 Minus
X 23527363 X 10776077..10776168 214..123 235 83.6 Minus
Blast to na_te.dros performed on 2019-03-16 22:47:37 has no hits.

AT01047.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:48:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13548782..13549372 1..591 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:47:15 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 117..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:03:11 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 117..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:13:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 117..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:47:47 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 117..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:43:03 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 117..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:48:43 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 19..609 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:03:11 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 19..609 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:13:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 19..609 1..591 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:47:47 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 19..609 1..591 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:43:03 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 19..609 1..591 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17724436..17725026 1..591 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17724436..17725026 1..591 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17724436..17725026 1..591 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:13:32 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550158..13550748 1..591 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:22:56 Download gff for AT01047.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17465267..17465857 1..591 100   Minus

AT01047.hyp Sequence

Translation from 2 to 478

> AT01047.hyp
YIVPSNSGRQLHKTFVPNPKRKPIFRSVSIRTVFQSAQMDMNYQYKKDHS
FDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKKYLVPADLTVGQF
YFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEHFDKDYFLYISYT
DENVYGRQ*

AT01047.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-PB 120 CG12334-PB 1..120 39..158 641 100 Plus
Atg8b-PA 120 CG12334-PA 1..120 39..158 641 100 Plus
Atg8a-PA 121 CG32672-PA 1..116 41..156 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..102 61..156 401 78.1 Plus
Atg8a-PB 96 CG32672-PB 6..91 71..156 395 84.9 Plus

AT01047.pep Sequence

Translation from 116 to 478

> AT01047.pep
MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKK
YLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEH
FDKDYFLYISYTDENVYGRQ*

AT01047.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23138-PA 122 GF23138-PA 1..118 1..118 576 92.4 Plus
Dana\GF20824-PA 121 GF20824-PA 1..116 3..118 526 82.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16757-PA 120 GG16757-PA 1..120 1..120 613 96.7 Plus
Dere\GG18902-PA 121 GG18902-PA 1..116 3..118 525 82.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15861-PA 125 GH15861-PA 1..120 1..120 528 80 Plus
Dgri\GH12106-PA 119 GH12106-PA 1..116 3..118 525 82.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-PB 120 CG12334-PB 1..120 1..120 641 100 Plus
Atg8b-PA 120 CG12334-PA 1..120 1..120 641 100 Plus
Atg8a-PA 121 CG32672-PA 1..116 3..118 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..102 23..118 401 78.1 Plus
Atg8a-PB 96 CG32672-PB 6..91 33..118 395 84.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23636-PA 122 GI23636-PA 1..120 1..120 545 84.2 Plus
Dmoj\GI15162-PA 119 GI15162-PA 1..118 3..120 526 81.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12240-PA 116 GL12240-PA 1..116 1..116 534 86.2 Plus
Dper\GL26902-PA 120 GL26902-PA 1..116 3..118 524 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11562-PA 116 GA11562-PA 1..116 1..116 534 86.2 Plus
Dpse\GA23118-PA 116 GA23118-PA 1..116 1..116 534 86.2 Plus
Dpse\GA22662-PA 120 GA22662-PA 1..116 3..118 524 82.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15346-PA 266 GM15346-PA 147..266 1..120 646 100 Plus
Dsec\GM11288-PA 121 GM11288-PA 1..116 3..118 525 82.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20217-PA 227 GD20217-PA 108..227 1..120 644 100 Plus
Dsim\GD16015-PA 121 GD16015-PA 1..116 3..118 525 82.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24711-PA 124 GJ24711-PA 1..120 1..120 539 83.3 Plus
Dvir\GJ14868-PA 119 GJ14868-PA 1..116 3..118 525 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22506-PA 121 GK22506-PA 1..120 1..120 567 88.3 Plus
Dwil\GK16501-PA 119 GK16501-PA 1..116 3..118 526 82.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25252-PA 120 GE25252-PA 1..120 1..120 622 99.2 Plus
Dyak\GE15373-PA 121 GE15373-PA 1..116 3..118 525 82.8 Plus