Clone AT01178 Report

Search the DGRC for AT01178

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:11
Well:78
Vector:pOTB7
Associated Gene/TranscriptMESK2-RK
Protein status:AT01178.pep: gold
Preliminary Size:5233
Sequenced Size:1555

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15669 2002-09-19 Blastp of sequenced clone
MESK2 2008-04-29 Release 5.5 accounting
MESK2 2008-08-15 Release 5.9 accounting
MESK2 2008-12-18 5.12 accounting

Clone Sequence Records

AT01178.complete Sequence

1555 bp (1555 high quality bases) assembled on 2002-09-19

GenBank Submission: BT001255

> AT01178.complete
ATAAATCAGAAATCAAGCGAAAGACCCAAAAAAGCATGCCACAGTCAGAG
GGCGGCTATGTATCGCTGCCGGCCGTCAATGGCAATGGCGGCGCCATCTA
TCAGTCGACCACAGAGCCCACGGCCCCGCCCTCCGTTTTTGCGAGCGTGA
AGCGGGCCATTGGCCAGGCCATCAAGTCCTCGCCCACCGACAGCGAGGAG
CTGCTCCGGTCGGACCGCCTGCCGGTCATCGTCGGCGGCTCCAGCACCAT
GCCCGTTGATCCCATGGATGACATCGAACTGCGCTCCGTGCAGCTGCAAT
TCCCCAATGCCCGCGGCTCCATCCTGGAGGCCTGCGAACAGCGACGCGTG
CCCACAGACAAGGGCGATGTCCACGTGGCCATACAGGGCGATACGGCCAA
GCCGGCCATTATCACCTACCACGATTTGGGCCTCAACTACGCCACCAGCT
TTGCTGGCTTCTTCAATTTTCCAGTGATGCGAGGTTTGCTGGAGAACTTC
TGTGTTTACCATGTGACTGCTCCTGGCCAGGAGGAGGGTGCACCCACTTT
GCCAGAGGATTACGTGTATCCGACCATGGATGATCTGGCCGCCCAGCTGC
TTTTCGTGCTATCCCACTTTGGCCTGAAGTCGGTGATTGGTTTCGGCGTT
GGGGCCGGGGCGAATATTCTGGCCCGTTTCGCTCACGCCCATCCGGACAA
GGTGGGCGCCCTGTGCCTGATCAATTGCGTGTCCACGCAGTCGGGCTGGA
TCGAGTGGGGCTACCAGAGCTTCAATGCCCGCTTCTTGCGCACCAAGGGC
ATGACACAGGGCGTGATCGATTATCTGATGTGGCACCACTTTGGACGCAA
TCCGGAGGAGCGCAATCACGACCTGGTGCAGATGTACAAGCAGCACTTCG
AGCGTGGCGTTAATCCGACCAATCTTGCCATGCTGATCAACGCGTACATC
CATCGCAACGACCTGCATCTGGCGCGCACTCCGCCAGGAACTCCGGGCAG
CGAAACGGCGGCCACCACGCTGAAGATGCCGGTGATCAATATTACGGGTT
CGCTCTCGCCGCACGTCGACGACACGGTGACCTTCAATGGCCGTCTAGAT
CCTACAAACTCATCGTGGATGAAGATTTCCGATTGCGCTTTGGTGCTGGA
GGAGCAGCCGGCTAAGCTGGCCGAGGCCTTCCGGCTCTTCTTGCAGGGCG
AGGGCTACGTCAAGTACTTCCGACCCGGCGACTGGGATGGCACTCAGTTG
AGCAGCTTCATCTAGAAGTCCATTCCGTTTGGAGCAAGATATCCCCTCCA
TAGATTCAGTTCAGTTCAGTTCAGCTCAGTTTTCCCACAGGAGATGCTCC
TCCTAGCTTAGCCCCCGATTTTCTCCGTGGAGACACACGCACACACAAAG
TACACAAACGTCCCTGACCCAACCTGATTTTAGTCTAAACGAAAATCTTT
GAGAATCAAAAGCTTTTTGAGATGCATTGAAACGAAACCAAAAATCTATT
GTGCAAAATTTTATATTTACAAATTGGTTAGATATACAAAAAAAAAAAAA
AAAAA

AT01178.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:41:56
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2.r 1941 MESK2.r 648..1941 244..1537 6305 99.1 Plus
MESK2.n 2189 MESK2.n 896..2189 244..1537 6305 99.1 Plus
MESK2-RC 2240 MESK2-RC 947..2240 244..1537 6305 99.1 Plus
MESK2.r 1941 MESK2.r 321..564 1..244 1220 100 Plus
MESK2.n 2189 MESK2.n 569..812 1..244 1220 100 Plus
MESK2-RC 2240 MESK2-RC 620..863 1..244 1220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17397894..17398458 560..1124 2690 98.4 Plus
chr2R 21145070 chr2R 17398882..17399210 1209..1537 1645 100 Plus
chr2R 21145070 chr2R 17393955..17394200 1..244 1165 99.2 Plus
chr2R 21145070 chr2R 17397347..17397542 243..438 980 100 Plus
chr2R 21145070 chr2R 17397605..17397725 439..559 575 98.3 Plus
chr2R 21145070 chr2R 17398581..17398667 1123..1209 435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:36:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21511404..21511968 560..1124 2690 98.4 Plus
2R 25286936 2R 21512392..21512737 1209..1554 1715 99.7 Plus
2R 25286936 2R 21507479..21507722 1..244 1220 100 Plus
2R 25286936 2R 21510865..21511060 243..438 980 100 Plus
2R 25286936 2R 21511123..21511243 439..559 575 98.3 Plus
2R 25286936 2R 21512091..21512177 1123..1209 435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21512603..21513167 560..1124 2690 98.4 Plus
2R 25260384 2R 21513591..21513936 1209..1554 1715 99.7 Plus
2R 25260384 2R 21508678..21508921 1..244 1220 100 Plus
2R 25260384 2R 21512064..21512259 243..438 980 100 Plus
2R 25260384 2R 21512322..21512442 439..559 575 98.3 Plus
2R 25260384 2R 21513290..21513376 1123..1209 435 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:27:32 has no hits.

AT01178.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:28:35 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17398883..17399210 1210..1537 91   Plus
chr2R 17393955..17394200 1..244 99 -> Plus
chr2R 17397349..17397542 245..438 100 -> Plus
chr2R 17397605..17397725 439..559 98 -> Plus
chr2R 17397894..17398458 560..1124 98 -> Plus
chr2R 17398583..17398667 1125..1209 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:47:29 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 1..1230 36..1265 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:14:48 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 1..1230 36..1265 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:48:13 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 1..1230 36..1265 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:05:48 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 1..1230 36..1265 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:53:39 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 1..1230 36..1265 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:38:05 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 579..2115 1..1537 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:14:48 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 579..2115 1..1537 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:48:13 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 568..2104 1..1537 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:05:48 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 579..2115 1..1537 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:53:39 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RK 568..2104 1..1537 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:35 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21507479..21507722 1..244 100 -> Plus
2R 21510867..21511060 245..438 100 -> Plus
2R 21511123..21511243 439..559 98 -> Plus
2R 21511404..21511968 560..1124 98 -> Plus
2R 21512093..21512177 1125..1209 100 -> Plus
2R 21512393..21512720 1210..1537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:35 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21507479..21507722 1..244 100 -> Plus
2R 21510867..21511060 245..438 100 -> Plus
2R 21511123..21511243 439..559 98 -> Plus
2R 21511404..21511968 560..1124 98 -> Plus
2R 21512093..21512177 1125..1209 100 -> Plus
2R 21512393..21512720 1210..1537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:35 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21507479..21507722 1..244 100 -> Plus
2R 21510867..21511060 245..438 100 -> Plus
2R 21511123..21511243 439..559 98 -> Plus
2R 21511404..21511968 560..1124 98 -> Plus
2R 21512093..21512177 1125..1209 100 -> Plus
2R 21512393..21512720 1210..1537 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:48:13 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17394984..17395227 1..244 100 -> Plus
arm_2R 17398372..17398565 245..438 100 -> Plus
arm_2R 17398628..17398748 439..559 98 -> Plus
arm_2R 17398909..17399473 560..1124 98 -> Plus
arm_2R 17399598..17399682 1125..1209 100 -> Plus
arm_2R 17399898..17400225 1210..1537 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:37:40 Download gff for AT01178.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21512066..21512259 245..438 100 -> Plus
2R 21512322..21512442 439..559 98 -> Plus
2R 21508678..21508921 1..244 100 -> Plus
2R 21512603..21513167 560..1124 98 -> Plus
2R 21513292..21513376 1125..1209 100 -> Plus
2R 21513592..21513919 1210..1537 100   Plus

AT01178.hyp Sequence

Translation from 2 to 1264

> AT01178.hyp
KSEIKRKTQKSMPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVK
RAIGQAIKSSPTDSEELLRSDRLPVIVGGSSTMPVDPMDDIELRSVQLQF
PNARGSILEACEQRRVPTDKGDVHVAIQGDTAKPAIITYHDLGLNYATSF
AGFFNFPVMRGLLENFCVYHVTAPGQEEGAPTLPEDYVYPTMDDLAAQLL
FVLSHFGLKSVIGFGVGAGANILARFAHAHPDKVGALCLINCVSTQSGWI
EWGYQSFNARFLRTKGMTQGVIDYLMWHHFGRNPEERNHDLVQMYKQHFE
RGVNPTNLAMLINAYIHRNDLHLARTPPGTPGSETAATTLKMPVINITGS
LSPHVDDTVTFNGRLDPTNSSWMKISDCALVLEEQPAKLAEAFRLFLQGE
GYVKYFRPGDWDGTQLSSFI*

AT01178.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2-PK 409 CG15669-PK 1..409 12..420 2168 100 Plus
MESK2-PC 437 CG15669-PC 1..437 12..420 2125 93.4 Plus
MESK2-PB 425 CG15669-PB 1..420 12..403 2028 93.1 Plus
MESK2-PE 447 CG15669-PE 1..419 12..402 2024 93.1 Plus
MESK2-PF 447 CG15669-PF 1..419 12..402 2024 93.1 Plus

AT01178.pep Sequence

Translation from 35 to 1264

> AT01178.pep
MPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVKRAIGQAIKSSP
TDSEELLRSDRLPVIVGGSSTMPVDPMDDIELRSVQLQFPNARGSILEAC
EQRRVPTDKGDVHVAIQGDTAKPAIITYHDLGLNYATSFAGFFNFPVMRG
LLENFCVYHVTAPGQEEGAPTLPEDYVYPTMDDLAAQLLFVLSHFGLKSV
IGFGVGAGANILARFAHAHPDKVGALCLINCVSTQSGWIEWGYQSFNARF
LRTKGMTQGVIDYLMWHHFGRNPEERNHDLVQMYKQHFERGVNPTNLAML
INAYIHRNDLHLARTPPGTPGSETAATTLKMPVINITGSLSPHVDDTVTF
NGRLDPTNSSWMKISDCALVLEEQPAKLAEAFRLFLQGEGYVKYFRPGDW
DGTQLSSFI*

AT01178.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12819-PA 448 GF12819-PA 1..420 1..391 2010 90 Plus
Dana\GF18647-PA 370 GF18647-PA 23..311 98..392 398 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22116-PA 570 GG22116-PA 1..422 1..392 2053 91.9 Plus
Dere\GG10854-PA 367 GG10854-PA 20..308 98..392 401 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21835-PA 450 GH21835-PA 1..422 1..391 1982 87.9 Plus
Dgri\GH19438-PA 362 GH19438-PA 19..308 97..392 401 31.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2-PK 409 CG15669-PK 1..409 1..409 2168 100 Plus
MESK2-PC 437 CG15669-PC 1..437 1..409 2125 93.4 Plus
MESK2-PB 425 CG15669-PB 1..420 1..392 2028 93.1 Plus
MESK2-PE 447 CG15669-PE 1..419 1..391 2024 93.1 Plus
MESK2-PF 447 CG15669-PF 1..419 1..391 2024 93.1 Plus
MESK2-PA 447 CG15669-PA 1..419 1..391 2024 93.1 Plus
MESK2-PI 485 CG15669-PI 17..337 71..391 1717 100 Plus
MESK2-PD 365 CG15669-PD 17..337 71..391 1717 100 Plus
MESK2-PJ 468 CG15669-PJ 1..320 72..391 1712 100 Plus
CG2082-PA 365 CG2082-PA 21..304 98..390 383 32.7 Plus
CG2082-PJ 361 CG2082-PJ 24..300 105..390 381 33.1 Plus
CG2082-PC 361 CG2082-PC 24..300 105..390 381 33.1 Plus
CG2082-PG 368 CG2082-PG 21..307 98..390 378 32.1 Plus
CG2082-PL 363 CG2082-PL 24..302 105..390 377 32.6 Plus
CG2082-PH 363 CG2082-PH 24..302 105..390 377 32.6 Plus
CG2082-PK 364 CG2082-PK 24..303 105..390 376 32.6 Plus
CG2082-PB 364 CG2082-PB 24..303 105..390 376 32.6 Plus
CG2082-PO 335 CG2082-PO 1..230 148..390 315 31.9 Plus
CG2082-PD 201 CG2082-PD 21..197 98..272 285 37.4 Plus
CG2082-PN 197 CG2082-PN 24..193 105..272 283 38.3 Plus
CG2082-PM 211 CG2082-PM 29..200 101..270 281 37.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19078-PA 549 GI19078-PA 1..423 1..392 1950 86.3 Plus
Dmoj\GI22641-PA 361 GI22641-PA 26..307 105..392 405 32 Plus
Dmoj\GI17264-PA 73 GI17264-PA 1..70 1..68 255 77.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16980-PA 563 GL16980-PA 19..433 6..392 1964 88.2 Plus
Dper\GL23012-PA 368 GL23012-PA 21..309 98..392 393 31.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25012-PF 394 GA25012-PF 1..393 1..393 2024 94.7 Plus
Dpse\GA25012-PB 447 GA25012-PB 1..419 1..391 1990 88.3 Plus
Dpse\GA25012-PH 425 GA25012-PH 1..420 1..392 1986 88.3 Plus
Dpse\GA25012-PC 422 GA25012-PC 1..421 1..393 1982 88.1 Plus
Dpse\GA25012-PD 470 GA25012-PD 17..338 71..392 1721 96.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15838-PA 447 GM15838-PA 1..419 1..391 2074 93.1 Plus
Dsec\GM10591-PA 383 GM10591-PA 36..324 98..392 400 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11599-PA 536 GD11599-PA 1..420 1..392 2073 92.9 Plus
Dsim\GD19583-PA 368 GD19583-PA 21..309 98..392 400 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20053-PA 553 GJ20053-PA 1..425 1..392 1949 86.6 Plus
Dvir\GJ23888-PA 360 GJ23888-PA 7..306 90..392 387 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20902-PA 562 GK20902-PA 1..428 1..392 1909 84.6 Plus
Dwil\GK13862-PA 388 GK13862-PA 40..328 98..392 395 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12198-PA 429 GE12198-PA 1..424 1..392 2049 91.7 Plus
Dyak\GE24139-PA 368 GE24139-PA 21..309 98..392 400 31.9 Plus