Clone AT01237 Report

Search the DGRC for AT01237

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:12
Well:37
Vector:pOTB7
Associated Gene/TranscriptCG33218-RA
Protein status:AT01237.pep: wuzgold
Sequenced Size:635

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG33218 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

AT01237.complete Sequence

635 bp assembled on 2009-07-28

GenBank Submission: BT088964.1

> AT01237.complete
ACGAGCACTAGCACACGAATAGATTTTCCACAACGTTGAGCATATGCAAA
CATCTAAATTCTACGGTTCTACATTCGATTCCATTCGATTCGATTACGAT
TGCCCTCGTTTTTCAGTTTTCTTCGAGATCCGTTTCTATGGCTAAAATAA
ATCTTTGGTTGGGTAAACTCCGTGACTCTGTTCTGTCCAGGCTGCAGAGC
ATCAAGAAACCCCTACCCCTTCCTTCGACCAAGGGCCCCCTCAATGCCAA
TGAAACCTCAAATTCCGAAGGTAATATTAGTGACTTTCAGCAGGGCGATC
CAATAATTCCACCCATCGAAGCTAACAAAATGATACCGAGGCCTCAAAAT
GGATTCGTCAGCCGAGCCCTCTACTACCGAGGATACTACATTAGGCGTTA
AAGGATTCGTGCCTAACATGAAATTCAGTATAAATTGAAAATTTTACACA
CCGGACTCGTAGTCTCGGATTAACCAAATCGAGCCTTGAAACACCGGCTA
TGTTACAAATTAGCTCAGTAATTTCTTGAACTTTAACAAATCATCAGCAG
TGAAATAAGCATGTGCAACATTTGGTCTAAAATCAATCAATCAATAAACA
TTTGTACCTTTAAAAAAAAAAAAAAAAAAAAAAAA

AT01237.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33218-RA 810 CG33218-RA 121..731 1..611 3040 99.8 Plus
CG33218.a 1237 CG33218.a 548..1158 1..611 3040 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2224335..2224750 196..611 2065 99.8 Plus
chrX 22417052 chrX 2224083..2224279 1..197 955 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:36:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2330411..2330826 196..611 2080 100 Plus
X 23542271 X 2330159..2330355 1..197 970 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2338509..2338924 196..611 2080 100 Plus
X 23527363 X 2338257..2338453 1..197 970 99.4 Plus
Blast to na_te.dros performed 2019-03-16 00:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Stalker 7256 Stalker STALKER 7256bp 1360..1403 109..151 109 75 Plus

AT01237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:24 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2224083..2224279 1..197 98 -> Plus
chrX 2224337..2224750 198..611 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:57 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 1..264 138..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:27 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 1..264 138..401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 14:38:40 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 1..611 1..611 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:27 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
CG33218-RA 1..611 1..611 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:24 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330159..2330355 1..197 99 -> Plus
X 2330413..2330826 198..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:24 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330159..2330355 1..197 99 -> Plus
X 2330413..2330826 198..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:24 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
X 2330159..2330355 1..197 99 -> Plus
X 2330413..2330826 198..611 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:17 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224192..2224388 1..197 99 -> Plus
arm_X 2224446..2224859 198..611 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:17 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224192..2224388 1..197 99 -> Plus
arm_X 2224446..2224859 198..611 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:17 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2224192..2224388 1..197 99 -> Plus
arm_X 2224446..2224859 198..611 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:20 Download gff for AT01237.complete
Subject Subject Range Query Range Percent Splice Strand
X 2338511..2338924 198..611 100   Plus
X 2338257..2338453 1..197 99 -> Plus

AT01237.hyp Sequence

Translation from 137 to 400

> AT01237.hyp
MAKINLWLGKLRDSVLSRLQSIKKPLPLPSTKGPLNANETSNSEGNISDF
QQGDPIIPPIEANKMIPRPQNGFVSRALYYRGYYIRR*
Sequence AT01237.hyp has no blast hits.

AT01237.pep Sequence

Translation from 137 to 400

> AT01237.pep
MAKINLWLGKLRDSVLSRLQSIKKPLPLPSTKGPLNANETSNSEGNISDF
QQGDPIIPPIEANKMIPRPQNGFVSRALYYRGYYIRR*

AT01237.pep Blast Records

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19222-PA 105 GM19222-PA 1..105 1..87 291 61.8 Plus