Clone AT01876 Report

Search the DGRC for AT01876

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:18
Well:76
Vector:pOTB7
Associated Gene/TranscriptCG17744-RA
Protein status:AT01876.pep: gold
Preliminary Size:717
Sequenced Size:954

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17744 2002-01-01 Sim4 clustering to Release 2
CG17744 2002-02-22 Blastp of sequenced clone
CG17744 2003-01-01 Sim4 clustering to Release 3
CG17744 2008-04-29 Release 5.5 accounting
CG17744 2008-08-15 Release 5.9 accounting
CG17744 2008-12-18 5.12 accounting

Clone Sequence Records

AT01876.complete Sequence

954 bp (954 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089222

> AT01876.complete
CTTCAACTTGCCACATTATATTTTTTTTCCACCATGGAGTCTGCTAAAGT
CCTAAATAAACTATTGAAGGAAGCTCCCAAAGATTCAAAAGGAAGCAAAG
AGATTGAAGAGTTACGAAACCTGATCATAGAGCTGATGAAACCACGACTG
GGACAACTACTTCAGATACTAAAGACTCGCATGATAGCTTCCACTCGAGA
TGAGTTTCAAGATGAAAATGAAGACTGGTGGCCAGATTATGAGCTATTAT
CAGCAGACTGGAGAGCCTTCACAGATATGAATGGTCTTTTAGTCTGCACT
CAGAATGCTTTAAAGGGACTACCGGGTGATCTTAAGGCCATTGGTGAAAA
GTTCGATTATGCCTATTCCGTTGCAAAGCCTATAACTGCTCGAAATAAGA
CCAAAAACTATTTTTTAGTAGTGGAACTTATAGAGGACATGGAGGACTTT
GTAACGCACCTCAGCCGCCTGTGTAGCAAGAATCTGGACGAGCGAAGGGA
CCTATACGATCTGGCTTCGATAACTAAAGATACTGGCGATAGAATCAAGG
TGAAAGTCTTCGATGAACGCATCTTTGTGCAATTGCAGTCGCGAATTGCA
AGTCTTAGGAACTACATAAGGGACTTCTGTGCCCTTTTCGATGCCCACTT
GGAGTCCGAAGAGGAGGATGAATTCGAAACATTAGATATGTTGGCAAAAC
CCCAAGGACCACTTGCCACGGGAACCAATGCTGATAAGGCCCGGACTTAA
GCCAAATCGATCAGGAAGTCATCTCACCGTCTATTTCCATGGCATGGCTT
CCAACGGTTTTCATTGTACAATACCCACACTTGGAGCTACAGAACACAGA
AACATGACTCCGGCATATGGGCGGCAATAAAGAGTTCGCCTCCAGTGTAT
TGGAGTATCTGGGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

AT01876.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17744-RA 1076 CG17744-RA 105..1020 1..916 4535 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7018059..7018689 913..283 3110 99.5 Minus
chr3L 24539361 chr3L 7018757..7019040 283..1 1370 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:37:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7025798..7026431 916..283 3140 99.7 Minus
3L 28110227 3L 7026499..7026781 283..1 1400 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7018898..7019531 916..283 3140 99.6 Minus
3L 28103327 3L 7019599..7019881 283..1 1400 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 12:41:28 has no hits.

AT01876.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:42:23 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7018758..7019040 1..282 99   Minus
chr3L 7018059..7018689 283..913 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:48:44 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..717 34..750 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:44:24 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..717 34..750 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:54:38 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..717 34..750 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:12:25 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..717 34..750 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:51:36 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..717 34..750 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:08:56 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..913 1..913 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:44:24 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..913 1..913 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:54:38 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 14..926 1..913 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:12:26 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 1..913 1..913 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:51:36 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
CG17744-RA 14..926 1..913 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:23 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7025801..7026431 283..913 99 <- Minus
3L 7026500..7026781 1..282 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:23 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7025801..7026431 283..913 99 <- Minus
3L 7026500..7026781 1..282 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:42:23 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7025801..7026431 283..913 99 <- Minus
3L 7026500..7026781 1..282 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:54:38 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7018901..7019531 283..913 99 <- Minus
arm_3L 7019600..7019881 1..282 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:47:02 Download gff for AT01876.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7018901..7019531 283..913 99 <- Minus
3L 7019600..7019881 1..282 99   Minus

AT01876.hyp Sequence

Translation from 1 to 749

> AT01876.hyp
LQLATLYFFSTMESAKVLNKLLKEAPKDSKGSKEIEELRNLIIELMKPRL
GQLLQILKTRMIASTRDEFQDENEDWWPDYELLSADWRAFTDMNGLLVCT
QNALKGLPGDLKAIGEKFDYAYSVAKPITARNKTKNYFLVVELIEDMEDF
VTHLSRLCSKNLDERRDLYDLASITKDTGDRIKVKVFDERIFVQLQSRIA
SLRNYIRDFCALFDAHLESEEEDEFETLDMLAKPQGPLATGTNADKART*

AT01876.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17744-PA 238 CG17744-PA 1..238 12..249 1220 100 Plus

AT01876.pep Sequence

Translation from 33 to 749

> AT01876.pep
MESAKVLNKLLKEAPKDSKGSKEIEELRNLIIELMKPRLGQLLQILKTRM
IASTRDEFQDENEDWWPDYELLSADWRAFTDMNGLLVCTQNALKGLPGDL
KAIGEKFDYAYSVAKPITARNKTKNYFLVVELIEDMEDFVTHLSRLCSKN
LDERRDLYDLASITKDTGDRIKVKVFDERIFVQLQSRIASLRNYIRDFCA
LFDAHLESEEEDEFETLDMLAKPQGPLATGTNADKART*

AT01876.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24800-PA 238 GF24800-PA 1..224 1..227 661 57.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15007-PA 238 GG15007-PA 1..238 1..238 1067 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16087-PA 213 GH16087-PA 26..198 26..212 170 29.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG17744-PA 238 CG17744-PA 1..238 1..238 1220 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12350-PA 240 GI12350-PA 26..232 26..217 315 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25153-PA 239 GL25153-PA 1..225 1..227 406 40.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14640-PA 239 GA14640-PA 1..225 1..227 390 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13796-PA 238 GM13796-PA 1..238 1..238 1176 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13096-PA 238 GD13096-PA 1..237 1..237 1147 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12242-PA 241 GJ12242-PA 6..217 11..204 359 39.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20450-PA 235 GE20450-PA 1..235 1..238 1041 83.6 Plus