Clone AT02326 Report

Search the DGRC for AT02326

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:23
Well:26
Vector:pOTB7
Associated Gene/TranscriptCG8584-RA
Protein status:AT02326.pep: gold
Preliminary Size:991
Sequenced Size:1121

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8584 2002-01-01 Sim4 clustering to Release 2
CG8584 2002-02-26 Blastp of sequenced clone
CG8584 2003-01-01 Sim4 clustering to Release 3
CG8584 2008-04-29 Release 5.5 accounting
CG8584 2008-08-15 Release 5.9 accounting
CG8584 2008-12-18 5.12 accounting

Clone Sequence Records

AT02326.complete Sequence

1121 bp (1121 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089227

> AT02326.complete
GTTTTCGGGGATCCCTGTCAGCCCTGCGTCTACTGACACTTCCCATTCGG
CCCAATACACCAGCAGAACTCTTAAATTGACTCCAATGTAAGGACGGGAT
ATAATGTAAGACAGCGAGCCGACTCCACTAGCCTGTGCATTGAAATTGAA
AGGACTCGGGTGCAAAATGGTCAGTCAGCTGCCCGCACAGTCTGCTGATT
TAGACAAGCTCGCTCCATCAGGTCAGTTTGCCGTCGCTGTGGTCAGCAAT
CTCCAGAGATCGCGTTCGAGCTCCGATCGCCGGGGGCTCGTCTTGATCCT
GCTCTCCAGCGACCTGGGCACCTACATCAGACGCCTGCTGGCCCGTGTGG
CGGAGAAGGCATGTACGATCCTACGTACATATCTGGGGCTTAGCTACCGG
GAAGTGTCTGTGTCCCAGGACATGGCCCACAGACTGGCCGTGGTTGGTCG
GAAGACCCTGGTCCTGGACCTGGATGAGACTCTGGTGCACTCATGTTACC
TCGATCCGGACACCCACGACAACGTGGGATGCAGCCAGTTGCCCGAACAC
GCACAACCGGACTATGTGCTCAATATTTCCATCGACGGGATGGAACCTAT
CGTTTTCCGGGTCTTCAAGCGGCCGCATGTAGACGAGTTCCTGGACTTTG
TGTCCAAGTGGTACGACCTGGTGATCTATACGGCCAGCCTGGAGGTCTAT
GCCGCCCAGGTTGTGGACCATCTGGACGCGGGGCGAGGATTGATTACTCG
CCGCTTCTATCGCCAGCACTGTCGAGCCTCCTCGCCAATGGTCTCCAAGG
ACCTGACATTGGTCACCCCTGACATGAGCGGCGTTTTAATCATCGACAAC
TCGCCGTACGCATACCGCGACTTTCCCGACAACGCTATTCCCATTAAGAC
CTTCATCTACGACCCCGACGACACGGAGCTCCTGAAGATGCTGCCCTTCC
TCGATGCCCTGCGCTTCACCAAGGACGTTCGCTCCATTCTCGGTCGGCGC
GTTATCCGCCATTATTATAACCGATCTACCATTTCATCCCATCATTGAAC
GAATTCACTGTATTTCTATATGGTTAGAATAAATAAAGAAAAATTCCTAA
AACAAAAAAAAAAAAAAAAAA

AT02326.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG8584-RA 1103 CG8584-RA 1..1103 1..1103 5440 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4588271..4589373 1103..1 5440 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:37:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8700690..8701794 1105..1 5450 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8701889..8702993 1105..1 5450 99.5 Minus
Blast to na_te.dros performed on 2019-03-15 17:36:42 has no hits.

AT02326.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:37:24 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4588271..4589373 1..1103 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:49:13 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..882 167..1048 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:34:36 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..882 167..1048 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:41:56 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..882 167..1048 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:06:39 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..882 167..1048 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:42:53 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..882 167..1048 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:00:21 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..1103 1..1103 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:34:36 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..1103 1..1103 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:41:56 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..1103 1..1103 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:06:39 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..1103 1..1103 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:42:53 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
CG8584-RA 1..1103 1..1103 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:24 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8700692..8701794 1..1103 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:24 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8700692..8701794 1..1103 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:37:24 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8700692..8701794 1..1103 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:41:56 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4588197..4589299 1..1103 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:40:31 Download gff for AT02326.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8701891..8702993 1..1103 99   Minus

AT02326.hyp Sequence

Translation from 166 to 1047

> AT02326.hyp
MVSQLPAQSADLDKLAPSGQFAVAVVSNLQRSRSSSDRRGLVLILLSSDL
GTYIRRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVL
DLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVF
KRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQ
HCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDP
DDTELLKMLPFLDALRFTKDVRSILGRRVIRHYYNRSTISSHH*

AT02326.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8584-PA 293 CG8584-PA 1..293 1..293 1502 100 Plus
Dd-PB 240 CG1696-PB 31..237 69..282 526 50.7 Plus
Dd-PA 243 CG1696-PA 37..240 72..282 520 50.9 Plus
CG12078-PB 236 CG12078-PB 20..227 63..277 370 40.3 Plus
CG12078-PA 253 CG12078-PA 37..244 63..277 370 40.3 Plus

AT02326.pep Sequence

Translation from 166 to 1047

> AT02326.pep
MVSQLPAQSADLDKLAPSGQFAVAVVSNLQRSRSSSDRRGLVLILLSSDL
GTYIRRLLARVAEKACTILRTYLGLSYREVSVSQDMAHRLAVVGRKTLVL
DLDETLVHSCYLDPDTHDNVGCSQLPEHAQPDYVLNISIDGMEPIVFRVF
KRPHVDEFLDFVSKWYDLVIYTASLEVYAAQVVDHLDAGRGLITRRFYRQ
HCRASSPMVSKDLTLVTPDMSGVLIIDNSPYAYRDFPDNAIPIKTFIYDP
DDTELLKMLPFLDALRFTKDVRSILGRRVIRHYYNRSTISSHH*

AT02326.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12569-PA 282 GF12569-PA 1..279 1..279 1018 68.5 Plus
Dana\GF21841-PA 218 GF21841-PA 12..215 72..282 519 50.9 Plus
Dana\GF24377-PA 264 GF24377-PA 62..243 88..277 362 42.6 Plus
Dana\GF10364-PA 329 GF10364-PA 83..253 89..275 280 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10624-PA 294 GG10624-PA 1..293 1..292 1262 85.7 Plus
Dere\GG17544-PA 243 GG17544-PA 15..240 57..282 522 47.9 Plus
Dere\GG14268-PA 260 GG14268-PA 63..242 88..275 355 43.1 Plus
Dere\GG13507-PA 324 GG13507-PA 83..253 89..275 281 37.4 Plus
Dere\GG21359-PA 305 GG21359-PA 124..281 126..275 158 31.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21358-PA 294 GH21358-PA 56..288 47..278 731 59.2 Plus
Dgri\GH12888-PA 243 GH12888-PA 12..240 43..282 534 48.1 Plus
Dgri\GH16757-PA 341 GH16757-PA 87..251 95..275 276 37.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8584-PA 293 CG8584-PA 1..293 1..293 1502 100 Plus
Dd-PB 240 CG1696-PB 31..237 69..282 526 50.7 Plus
Dd-PA 243 CG1696-PA 37..240 72..282 520 50.9 Plus
CG12078-PB 236 CG12078-PB 20..227 63..277 370 40.3 Plus
CG12078-PA 253 CG12078-PA 37..244 63..277 370 40.3 Plus
CG5830-PA 329 CG5830-PA 83..253 89..275 286 37.4 Plus
CG5830-PB 352 CG5830-PB 106..276 89..275 286 37.4 Plus
Dd-PC 182 CG1696-PC 120..179 223..282 198 65 Plus
ttm3-PA 343 CG6691-PA 133..290 126..275 158 30.8 Plus
Dd-PC 182 CG1696-PC 37..120 72..162 151 40.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20773-PA 313 GI20773-PA 68..311 43..285 775 60.7 Plus
Dmoj\GI14442-PA 243 GI14442-PA 37..240 72..282 519 50.5 Plus
Dmoj\GI12759-PA 245 GI12759-PA 21..216 89..277 397 45.7 Plus
Dmoj\GI13418-PA 331 GI13418-PA 87..251 95..275 273 37 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17365-PA 286 GL17365-PA 1..286 1..282 841 60.1 Plus
Dper\GL16570-PA 175 GL16570-PA 37..172 147..282 431 58.8 Plus
Dper\GL19342-PA 274 GL19342-PA 67..252 89..277 356 41.4 Plus
Dper\GL12819-PA 333 GL12819-PA 83..253 89..275 281 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21180-PA 286 GA21180-PA 1..286 1..282 831 59.4 Plus
Dpse\GA14238-PA 243 GA14238-PA 15..240 57..282 522 47.9 Plus
Dpse\GA25924-PA 306 GA25924-PA 99..284 89..277 356 41.4 Plus
Dpse\GA19163-PA 335 GA19163-PA 83..253 89..275 281 37.4 Plus
Dpse\GA25377-PA 349 GA25377-PA 141..303 126..286 154 30 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20669-PA 293 GM20669-PA 1..293 1..293 1405 94.5 Plus
Dsec\GM22628-PA 243 GM22628-PA 15..240 57..282 522 47.9 Plus
Dsec\GM14061-PA 253 GM14061-PA 37..244 63..277 369 39.2 Plus
Dsec\GM24453-PA 412 GM24453-PA 164..334 89..275 280 37.4 Plus
Dsec\GM14328-PA 401 GM14328-PA 195..357 126..286 160 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10142-PA 623 GD10142-PA 346..623 16..293 1344 94.2 Plus
Dsim\GD15269-PA 212 GD15269-PA 1..212 1..212 1000 94.8 Plus
Dsim\GD13336-PA 253 GD13336-PA 64..244 89..277 344 40.4 Plus
Dsim\GD24432-PA 139 GD24432-PA 12..135 72..202 305 49.2 Plus
Dsim\GD12523-PA 331 GD12523-PA 83..253 89..275 280 37.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20507-PA 305 GJ20507-PA 66..299 47..280 751 60.4 Plus
Dvir\GJ18780-PA 243 GJ18780-PA 15..240 57..282 523 47.4 Plus
Dvir\GJ15525-PA 288 GJ15525-PA 75..259 96..277 362 43.6 Plus
Dvir\GJ11778-PA 329 GJ11778-PA 86..250 95..275 276 37.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23052-PA 275 GK23052-PA 43..274 49..280 812 64.2 Plus
Dwil\GK16309-PA 243 GK16309-PA 12..240 43..282 529 48.5 Plus
Dwil\GK23622-PA 325 GK23622-PA 84..254 89..275 282 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:10:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22820-PA 294 GE22820-PA 1..293 1..292 1293 89.4 Plus
Dyak\GE15304-PA 243 GE15304-PA 15..240 57..282 522 47.9 Plus
Dyak\GE20696-PA 260 GE20696-PA 53..244 78..277 362 41.5 Plus
Dyak\GE23126-PA 325 GE23126-PA 83..253 89..275 281 37.4 Plus