Clone AT02555 Report

Search the DGRC for AT02555

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:25
Well:55
Vector:pOTB7
Associated Gene/TranscriptCG2336-RA
Protein status:AT02555.pep: gold
Preliminary Size:1032
Sequenced Size:1251

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2336 2002-01-01 Sim4 clustering to Release 2
CG2336 2002-02-22 Blastp of sequenced clone
CG2336 2003-01-01 Sim4 clustering to Release 3
CG2336 2008-04-29 Release 5.5 accounting

Clone Sequence Records

AT02555.complete Sequence

1251 bp (1251 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089235

> AT02555.complete
CGATTTTAATGATGTACAACAACCGACCCACGGCTATCAGTCTAGAAGAG
GAGGTTCAATATATCTATAAGTACCCTTTGCTGCCGACTCCACTGATTGA
TTATGGATTTATCTACAATCTGGTTTGCAACAAGCCTCGGGATGTCAGTG
TGCCGTTGATCCTAGAAATTGAGACAGAGTTCAAGTCCAAAGACAGTGCT
CCTGAGAAGCCAAAGAAGGTGCCTAGGCTTTCATACCATTCCCGATCGAG
TTCAATGAGTGAAGATGAACCGGAACCGGAAGTGCAAGTTAAATACCAGT
GGAACTCGCCGCGGCTGATGATTCTCTGCGAAGATGGAGACATCAATTGC
GCTTTGCACTATCTCGTTGAGTCTCTTCACGATCCCTTCGCCTGCAATGC
GGTGGCCACTCTTTTCTTGCAGGAATCCATATTGGAGGAGTTCGTGGATC
GCATAAGGGATCGCCTGGAACCGTTGAGCACGGATATCTCCGGGCATCCG
GTTTATATAATGACACTGGAGAGAATAGGTCACTTACAGGCAAAGAGAAT
AGTTGGAAATCCCAAGACTGTTCCAGAAAATGCTAGTCCCATGCTGGTCT
ACGACCTTAGCCATCGTTACTTGGCTGATGGACCCACCGGGGTCATAACC
CTGCACACCTTTCGAACCATGAAGGAGGCCGTTGAGCTGCAGGCTAAGGA
ACCACTTAACTTTACCTCTGTGTGCATTTGGAACGAAAAACTGGCAGCCG
CCTACGAACTGGTGGCCCGATTAAGTCCGCTGATCTTCACGATTAATTGT
TACTACGTTAATCTGAACGAAATCACTCTGCCCTTCGTTTGCAACTTTAA
CTCCGCAAAGATTATCGACGGCTACCACTACGAGTCATTGACCTTTAAGG
GAAAGCGCAAAGTGGTTGTCCATCCAGTTGGCACCATCTGGGCAAAGTTG
GCCCGCGAGGCACTCGTCCAGTACTGATCTCTCCCATCGGGGGGTCGCAC
TCGAACTTCTTTTGACAGCCAATTTAAATTACTAGTCATTGATCTAGGGC
CTCTGGCTAATTGACTTTCCGGTTGGGCAACTCAATTACCAATTTAATTG
CTACAAAACGTCTGCCCGTCCCAAGAGTTTTGGCCTACATATTTTCCGGG
GAAACTCAACAGGCCGTTTCCCCGGCCTAATGGAAATTATGAGTGACTTT
GTATTGCGATATTAAAAATTCTTTCTGCGAAGTAAAAAAAAAAAAAAAAA
A

AT02555.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG2336-RA 1424 CG2336-RA 126..1360 1..1235 6175 100 Plus
CG2336.c 1362 CG2336.c 126..1362 1..1233 6100 99.6 Plus
CG2336.a 1268 CG2336.a 51..1268 16..1233 6075 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:44:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2406852..2408050 35..1233 5995 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6581073..6582273 35..1235 6005 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6321904..6323104 35..1235 6005 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:44:34 has no hits.

AT02555.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:21 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2406848..2408050 22..1233 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:49:37 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 1..969 9..977 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:43:50 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 1..969 9..977 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:52:40 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 1..969 9..977 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:12:07 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 1..969 9..977 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:52:48 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 1..969 9..977 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:08:24 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 56..1286 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:43:50 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 126..1358 1..1233 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:52:40 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 126..1358 1..1233 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:12:07 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 56..1286 1..1231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:52:48 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
CG2336-RA 126..1358 1..1233 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:21 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6581069..6582271 22..1233 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:21 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6581069..6582271 22..1233 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:21 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6581069..6582271 22..1233 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:52:40 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2406791..2407993 22..1233 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:46:38 Download gff for AT02555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6321900..6323102 22..1233 99   Plus

AT02555.pep Sequence

Translation from 8 to 976

> AT02555.pep
MMYNNRPTAISLEEEVQYIYKYPLLPTPLIDYGFIYNLVCNKPRDVSVPL
ILEIETEFKSKDSAPEKPKKVPRLSYHSRSSSMSEDEPEPEVQVKYQWNS
PRLMILCEDGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIR
DRLEPLSTDISGHPVYIMTLERIGHLQAKRIVGNPKTVPENASPMLVYDL
SHRYLADGPTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYE
LVARLSPLIFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESLTFKGKR
KVVVHPVGTIWAKLAREALVQY*

AT02555.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18368-PA 320 GF18368-PA 14..313 18..313 1019 63.3 Plus
Dana\GF16130-PA 294 GF16130-PA 59..293 80..312 523 43 Plus
Dana\GF21319-PA 253 GF21319-PA 16..252 80..312 506 46 Plus
Dana\GF21501-PA 310 GF21501-PA 84..299 101..318 372 40.2 Plus
Dana\GF16480-PA 279 GF16480-PA 1..250 51..309 286 28.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13512-PA 316 GG13512-PA 1..316 2..322 1483 90 Plus
Dere\GG17756-PA 256 GG17756-PA 42..255 97..312 558 49.1 Plus
Dere\GG12073-PA 291 GG12073-PA 69..290 93..312 557 45.5 Plus
Dere\GG21350-PA 296 GG21350-PA 61..273 99..310 420 40.7 Plus
Dere\GG20399-PA 279 GG20399-PA 1..250 51..309 328 29.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12691-PA 274 GH12691-PA 7..274 13..313 566 40.1 Plus
Dgri\GH10452-PA 306 GH10452-PA 78..292 100..317 511 44.7 Plus
Dgri\GH17535-PA 306 GH17535-PA 78..292 100..317 510 44.7 Plus
Dgri\GH17534-PA 176 GH17534-PA 1..162 153..317 323 39.8 Plus
Dgri\GH12022-PA 253 GH12022-PA 12..240 88..309 323 32.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG2336-PA 322 CG2336-PA 1..322 1..322 1693 100 Plus
CG12516-PB 300 CG12516-PB 30..298 45..311 559 41.3 Plus
CG15717-PE 252 CG15717-PE 38..250 97..311 531 48.8 Plus
CG15717-PC 252 CG15717-PC 38..250 97..311 531 48.8 Plus
CG15717-PA 252 CG15717-PA 38..250 97..311 531 48.8 Plus
CG11634-PB 298 CG11634-PB 66..276 99..308 435 42.9 Plus
CG11634-PA 298 CG11634-PA 66..276 99..308 435 42.9 Plus
CG5623-PA 279 CG5623-PA 36..250 98..309 313 32.1 Plus
CG13539-PB 260 CG13539-PB 30..256 90..307 287 29.8 Plus
CG13539-PA 260 CG13539-PA 30..256 90..307 287 29.8 Plus
CG12637-PA 292 CG12637-PA 23..238 98..306 282 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:32:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16366-PA 282 GI16366-PA 16..281 21..312 551 40.7 Plus
Dmoj\GI17704-PA 335 GI17704-PA 95..318 91..313 389 41.2 Plus
Dmoj\GI22587-PA 272 GI22587-PA 29..252 91..313 345 32 Plus
Dmoj\GI14293-PA 252 GI14293-PA 12..237 88..306 341 35.2 Plus
Dmoj\GI15524-PA 271 GI15524-PA 48..266 90..307 296 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21758-PA 320 GL21758-PA 4..306 11..317 950 59.9 Plus
Dper\GL23868-PA 301 GL23868-PA 67..300 80..312 625 51.7 Plus
Dper\GL14951-PA 265 GL14951-PA 31..264 88..312 540 46.6 Plus
Dper\GL25661-PA 286 GL25661-PA 1..261 50..307 336 29.7 Plus
Dper\GL21165-PA 280 GL21165-PA 48..274 90..307 289 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26390-PA 320 GA26390-PA 4..306 11..317 941 59.6 Plus
Dpse\GA11672-PA 301 GA11672-PA 67..300 80..312 613 50.4 Plus
Dpse\GA13910-PA 265 GA13910-PA 31..264 88..312 532 46.2 Plus
Dpse\GA11111-PA 322 GA11111-PA 33..297 30..307 340 29.3 Plus
Dpse\GA27755-PA 322 GA27755-PA 33..297 30..307 325 28.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:32:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10901-PA 319 GM10901-PA 1..319 2..322 1526 93.5 Plus
Dsec\GM16298-PA 291 GM16298-PA 4..290 24..312 554 38.5 Plus
Dsec\GM11602-PA 252 GM11602-PA 38..251 97..312 534 47.7 Plus
Dsec\GM16149-PA 298 GM16149-PA 66..276 99..308 421 42 Plus
Dsec\GM15991-PA 261 GM15991-PA 31..257 90..307 307 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19880-PA 321 GD19880-PA 1..321 1..322 1564 94.7 Plus
Dsim\GD18037-PA 300 GD18037-PA 13..299 24..312 554 38.8 Plus
Dsim\GD17100-PA 252 GD17100-PA 38..251 97..312 533 47.7 Plus
Dsim\GD24338-PA 298 GD24338-PA 48..276 82..308 424 40.4 Plus
Dsim\GD20331-PA 279 GD20331-PA 36..250 98..309 308 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16736-PA 280 GJ16736-PA 15..279 21..312 682 45.9 Plus
Dvir\GJ13210-PA 254 GJ13210-PA 34..254 93..313 550 48 Plus
Dvir\GJ11430-PA 333 GJ11430-PA 92..319 91..317 424 38.6 Plus
Dvir\GJ10307-PA 272 GJ10307-PA 25..252 87..313 344 30.6 Plus
Dvir\GJ19350-PA 246 GJ19350-PA 12..237 88..306 320 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11577-PA 271 GK11577-PA 1..268 34..311 676 48.2 Plus
Dwil\GK17389-PA 299 GK17389-PA 82..298 97..312 573 49.3 Plus
Dwil\GK24553-PA 296 GK24553-PA 12..295 28..312 488 34.8 Plus
Dwil\GK18716-PA 274 GK18716-PA 38..250 100..307 437 41.3 Plus
Dwil\GK11680-PA 275 GK11680-PA 36..253 98..316 315 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10227-PA 323 GE10227-PA 4..323 1..320 1478 87.8 Plus
Dyak\GE17046-PA 253 GE17046-PA 39..252 97..312 560 49.1 Plus
Dyak\GE10517-PA 273 GE10517-PA 74..272 91..312 480 42.2 Plus
Dyak\GE12931-PA 297 GE12931-PA 66..277 100..310 400 41.5 Plus
Dyak\GE26361-PA 279 GE26361-PA 5..250 67..309 326 30.9 Plus

AT02555.hyp Sequence

Translation from 29 to 976

> AT02555.hyp
SISLEEEVQYIYKYPLLPTPLIDYGFIYNLVCNKPRDVSVPLILEIETEF
KSKDSAPEKPKKVPRLSYHSRSSSMSEDEPEPEVQVKYQWNSPRLMILCE
DGDINCALHYLVESLHDPFACNAVATLFLQESILEEFVDRIRDRLEPLST
DISGHPVYIMTLERIGHLQAKRIVGNPKTVPENASPMLVYDLSHRYLADG
PTGVITLHTFRTMKEAVELQAKEPLNFTSVCIWNEKLAAAYELVARLSPL
IFTINCYYVNLNEITLPFVCNFNSAKIIDGYHYESLTFKGKRKVVVHPVG
TIWAKLAREALVQY*

AT02555.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG2336-PA 322 CG2336-PA 9..322 1..314 1644 99.7 Plus
CG12516-PB 300 CG12516-PB 30..298 37..303 559 41.3 Plus
CG15717-PE 252 CG15717-PE 38..250 89..303 531 48.8 Plus
CG15717-PC 252 CG15717-PC 38..250 89..303 531 48.8 Plus
CG15717-PA 252 CG15717-PA 38..250 89..303 531 48.8 Plus