Clone AT02668 Report

Search the DGRC for AT02668

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:26
Well:68
Vector:pOTB7
Associated Gene/TranscriptCG2209-RA
Protein status:AT02668.pep: gold
Sequenced Size:745

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2209 2009-06-05 Manual selection by Joe Carlson

Clone Sequence Records

AT02668.complete Sequence

745 bp assembled on 2009-07-28

GenBank Submission: BT088965.1

> AT02668.complete
AAAAAACAAAAAAAATGCCAGTTTTGAAACTTAATGCTTATTTCACCAAA
TTCTTCCCATCCTCGATGGTGCGTTCCAAGGAGTTGGTGCGAAGAAGGTA
TTCGATGAAGGTCGCGCAGGTGCGAAGATCTTACAACATAAAGTTCAATG
AAGATCCAGAATTCGAATGCGATGCCACAGTCACGAATATGCCCCAATCC
TTGAAGACTATGATTAAGAGGAAACTGCTCTCAAAGCGTGTGATCGGTAG
CTTTCGACTAAGATTCCATAGCAATTCGTTTAAGAAAAGGCTCGAGATCA
CAGCCACAATAACCAACCCAACAGTTCCGTCGGACACAGATCTCGCTCCG
GAGGATGAGCAGCTGTACGAGCTGTACATATGCAGTAGCCAGGGTCAATT
GCTGGGCAAGATTCCCTTCCTGGAGAGCGACTACCGGCGTGCAGCTCGCG
AGGCCATCGATTTCCTGGCCTTCTAGGCATTATCAAATTTTCAATTTTCG
ACATGCAGAGGAGGAATATATTTTATTCTGGCAACGACGACATGACAGCC
CTTATTTGCGATAGGCCACTATGCTGAACGGACTTTGATTATCGATTACC
TGTTACGACTCCATTTTCATATCTGCATATCCGCTTTGTGGGGAATGGCC
TGTAAAAAGCTGTAAAATTATATTTGGACCTCAATAAATTTACAATTAAC
TTACTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT02668.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG2209-RA 995 CG2209-RA 47..757 1..711 3540 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12913216..12913921 1..706 3530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:51:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13022244..13022954 1..711 3540 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13030342..13031052 1..711 3540 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 19:51:41 has no hits.

AT02668.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:52:58 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12913216..12913921 1..706 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:00 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 1..462 15..476 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:32 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 1..462 15..476 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:48:44 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 1..462 15..476 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:44:08 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 1..462 15..476 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 16:23:16 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 47..752 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:32 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 47..752 1..706 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:48:44 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 47..752 1..706 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:44:08 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
CG2209-RA 47..752 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:58 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
X 13022244..13022949 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:58 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
X 13022244..13022949 1..706 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:58 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
X 13022244..13022949 1..706 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:48:44 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12916277..12916982 1..706 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:24 Download gff for AT02668.complete
Subject Subject Range Query Range Percent Splice Strand
X 13030342..13031047 1..706 99   Plus

AT02668.hyp Sequence

Translation from 2 to 475

> AT02668.hyp
KTKKMPVLKLNAYFTKFFPSSMVRSKELVRRRYSMKVAQVRRSYNIKFNE
DPEFECDATVTNMPQSLKTMIKRKLLSKRVIGSFRLRFHSNSFKKRLEIT
ATITNPTVPSDTDLAPEDEQLYELYICSSQGQLLGKIPFLESDYRRAARE
AIDFLAF*

AT02668.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:45:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG2209-PA 153 CG2209-PA 1..153 5..157 777 100 Plus

AT02668.pep Sequence

Translation from 2 to 475

> AT02668.pep
KTKKMPVLKLNAYFTKFFPSSMVRSKELVRRRYSMKVAQVRRSYNIKFNE
DPEFECDATVTNMPQSLKTMIKRKLLSKRVIGSFRLRFHSNSFKKRLEIT
ATITNPTVPSDTDLAPEDEQLYELYICSSQGQLLGKIPFLESDYRRAARE
AIDFLAF*

AT02668.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21397-PA 150 GF21397-PA 67..143 77..154 211 55.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:20:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17750-PA 142 GG17750-PA 1..142 5..157 426 58.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG2209-PA 153 CG2209-PA 1..153 5..157 777 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11595-PA 153 GM11595-PA 1..153 5..157 631 77.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24801-PA 153 GD24801-PA 1..153 5..157 626 77.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16907-PA 154 GJ16907-PA 1..96 60..153 134 33.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17038-PA 142 GE17038-PA 1..140 5..155 401 56.3 Plus