Clone AT02774 Report

Search the DGRC for AT02774

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:27
Well:74
Vector:pOTB7
Associated Gene/TranscriptCG11333-RA
Protein status:AT02774.pep: gold
Preliminary Size:615
Sequenced Size:730

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11333 2002-01-01 Sim4 clustering to Release 2
CG11333 2002-04-21 Blastp of sequenced clone
CG11333 2003-01-01 Sim4 clustering to Release 3
CG11333 2008-04-29 Release 5.5 accounting
CG11333 2008-08-15 Release 5.9 accounting
CG11333 2008-12-18 5.12 accounting

Clone Sequence Records

AT02774.complete Sequence

730 bp (730 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113197

> AT02774.complete
CAATCATGAGCAAAGTCAGAGGACCAGCTTTGTACCGCCTGGTGCCCTCG
AAAACGCTCTTCATGCTGTGCGACGTGCAGGAGAAGTTCAAGCCGGCCAT
TCCGCTGCTAAGTTCGCTCATCGAAAACACTACTAAACTGCTGGCAGCCG
GCAAGGTCTTCCAAGTGCCACTGCTGGTCACCGAGCAGTATCCCGAGAGG
CTGGGCAAGACCGTTTGTGAGTTGGACATCAAGCATGCCTGTGCCAATAT
TTCCAAGACCATGTTCTCTATGCTGGTGGAGCCGGTACGTAAGAGTATGA
CTGATATCTTCGGTGGCAAGCCCAAGACGGTGGTGCTTTTCGGTCTGGAG
ACACACGTCTGTGTGGAGCAGACGGCCTTCGACCTGGTAAATGATGAAAT
CGATGTCTGGCTGGTGGCCGACTGCTGTGCGTCGCGTCACAATCAGGATC
GGGACTTGGCCTTGGAGCGCCTGCGTCACATTGGCTGCAACATAGCAACT
TCCGAGAGTGTGATATTTAATCTGCTGGGGGACAAGAACAACAAGTCCTT
CAAGGAGATTACTCCTCTGGTGAAGAAGATCTCCGCAGACATGCAGCTAT
GCCGCGTCTCAAAAAATTAAGCCTGGCGGCACTTTTCATGTCTTTCGCTC
AGTAAACCATCGCTATGTAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT02774.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11333-RA 775 CG11333-RA 97..757 1..661 3305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 27286142..27286454 349..661 1550 99.7 Plus
chr3R 27901430 chr3R 27285871..27286081 140..350 1055 100 Plus
chr3R 27901430 chr3R 27285675..27285814 1..140 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 31463812..31464124 349..661 1565 100 Plus
3R 32079331 3R 31463541..31463751 140..350 1055 100 Plus
3R 32079331 3R 31463345..31463484 1..140 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 31204643..31204955 349..661 1565 100 Plus
3R 31820162 3R 31204372..31204582 140..350 1055 100 Plus
3R 31820162 3R 31204176..31204315 1..140 700 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:46:17 has no hits.

AT02774.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:47:05 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 27285675..27285814 1..140 100 -> Plus
chr3R 27285872..27286081 141..350 100 -> Plus
chr3R 27286144..27286456 351..664 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:49:59 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..615 6..620 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:54:32 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..615 6..620 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:53:48 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..615 6..620 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:19:33 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..615 6..620 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:37 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..615 6..620 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:17:58 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..620 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:54:32 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:53:48 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:19:34 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 1..620 1..620 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:37 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
CG11333-RA 45..707 1..664 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:05 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31463345..31463484 1..140 100 -> Plus
3R 31463542..31463751 141..350 100 -> Plus
3R 31463814..31464126 351..664 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:05 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31463345..31463484 1..140 100 -> Plus
3R 31463542..31463751 141..350 100 -> Plus
3R 31463814..31464126 351..664 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:05 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31463345..31463484 1..140 100 -> Plus
3R 31463542..31463751 141..350 100 -> Plus
3R 31463814..31464126 351..664 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:53:48 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 27289536..27289848 351..664 99   Plus
arm_3R 27289067..27289206 1..140 100 -> Plus
arm_3R 27289264..27289473 141..350 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:53:54 Download gff for AT02774.complete
Subject Subject Range Query Range Percent Splice Strand
3R 31204373..31204582 141..350 100 -> Plus
3R 31204645..31204957 351..664 99   Plus
3R 31204176..31204315 1..140 100 -> Plus

AT02774.hyp Sequence

Translation from 2 to 619

> AT02774.hyp
IMSKVRGPALYRLVPSKTLFMLCDVQEKFKPAIPLLSSLIENTTKLLAAG
KVFQVPLLVTEQYPERLGKTVCELDIKHACANISKTMFSMLVEPVRKSMT
DIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVADCCASRHNQDR
DLALERLRHIGCNIATSESVIFNLLGDKNNKSFKEITPLVKKISADMQLC
RVSKN*

AT02774.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11333-PA 204 CG11333-PA 1..204 2..205 1049 100 Plus
CG3663-PA 208 CG3663-PA 8..196 13..201 583 58.7 Plus

AT02774.pep Sequence

Translation from 5 to 619

> AT02774.pep
MSKVRGPALYRLVPSKTLFMLCDVQEKFKPAIPLLSSLIENTTKLLAAGK
VFQVPLLVTEQYPERLGKTVCELDIKHACANISKTMFSMLVEPVRKSMTD
IFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVADCCASRHNQDRD
LALERLRHIGCNIATSESVIFNLLGDKNNKSFKEITPLVKKISADMQLCR
VSKN*

AT02774.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17786-PA 205 GF17786-PA 6..200 9..203 866 81.5 Plus
Dana\GF12999-PA 208 GF12999-PA 8..196 12..200 590 58.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11809-PA 204 GG11809-PA 1..204 1..204 1021 94.1 Plus
Dere\GG22997-PA 208 GG22997-PA 2..196 8..200 581 56.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19318-PA 183 GH19318-PA 1..173 20..198 691 70.4 Plus
Dgri\GH20327-PA 201 GH20327-PA 8..196 12..200 594 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11333-PA 204 CG11333-PA 1..204 1..204 1049 100 Plus
CG3663-PA 208 CG3663-PA 8..196 12..200 583 58.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22207-PA 209 GI22207-PA 8..198 8..198 760 73.3 Plus
Dmoj\GI19998-PA 201 GI19998-PA 8..196 12..200 611 59.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27251-PA 207 GL27251-PA 1..204 1..204 820 71.6 Plus
Dper\GL11107-PA 187 GL11107-PA 2..175 8..200 490 52.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10927-PA 207 GA10927-PA 1..203 1..203 817 71.9 Plus
Dpse\GA17597-PA 208 GA17597-PA 2..196 8..200 604 59.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12943-PA 204 GM12943-PA 1..204 1..204 1052 98 Plus
Dsec\GM11891-PA 208 GM11891-PA 2..196 8..200 598 58.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21579-PA 204 GD21579-PA 1..204 1..204 1053 98 Plus
Dsim\GD11889-PA 333 GD11889-PA 7..178 11..182 568 60.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24328-PA 209 GJ24328-PA 1..200 1..200 814 74 Plus
Dvir\GJ21248-PA 201 GJ21248-PA 8..196 12..200 597 58.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21424-PA 205 GK21424-PA 8..196 12..200 577 57.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10943-PA 204 GE10943-PA 1..204 1..204 1009 93.6 Plus
Dyak\GE14434-PA 208 GE14434-PA 2..196 8..200 590 57.4 Plus