Clone AT03158 Report

Search the DGRC for AT03158

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:31
Well:58
Vector:pOTB7
Associated Gene/TranscriptCG9222-RA
Protein status:AT03158.pep: gold
Preliminary Size:990
Sequenced Size:1286

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9222 2002-01-01 Sim4 clustering to Release 2
CG9222 2002-02-22 Blastp of sequenced clone
CG9222 2003-01-01 Sim4 clustering to Release 3
CG9222 2008-04-29 Release 5.5 accounting
CG9222 2008-08-15 Release 5.9 accounting
CG9222 2008-12-18 5.12 accounting

Clone Sequence Records

AT03158.complete Sequence

1286 bp (1286 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089244

> AT03158.complete
ATTGTATGTCACAGTATTGGAGAAAAATTCGCAAAATTTCTAGTTTCCTA
ATATGATAAATATTTAATGAGTCTTTGTTTGATCACGATATTCCCGTATT
ATTGGCGTCGTTGGTGAACCGTACTTGTGGTACCCTTTTTAATGGCGACA
TCTCCCAGAAGGAAAAACGATCAAGGCGGAGTAATTGGCGCTAGCTCATC
GCAGGACCTCGTCACTGACCAGAACTCGGGTCGTCGTCAGGAGCAGAAGG
TCTACACCTTCAGTGACCGGCCACCACAACCAAAGCCACCGGCACCATCC
GGAGTCGTTCCGGTAAAGGCCGACGACAAGTCGAAGCCGCAGAAAACCAT
TCTTGAGGAGCATGGCATCATACTCGGTAAGGTTATTGGCACCGGAAACT
ATGCCAAGGTGAAGATTGGCTTCTCCGAGGAGTACGGAAAGCGGGTGGCT
GTCAAGATCATATCCAAAGTGAAGGCTCCCTCCGAGTACACGCAAAAGTT
CCTGCCGCGAGAGATCGAGGCGGTGAAGGGTCTGCACCACGAAAATCTGA
TAACTTTTTATCAGAGCATCGAGACCAGTCATAGGGTGTACTTGATAATG
CAGCTGGCCGAGAATGGAACGCTTCTGGACTACGTCCGTGAGCGAAAGTT
TCTGGACGAGCCGCAATCACGTACGCTATTCAAGCAGCTGGTGAGTGCCG
TGGAGTACATCCACAGCAAGGGAGTGGTGCATCGGGATATTAAGTGCGAG
AATCTGCTGCTGGATGAGAACTGGAATCTGAAACTGATCGACTTCGGGTT
CGCAAGGAAGGATACCCGAACCTCCGACAATCAAGTGATACTCTCGAAAA
CCTTCTGCGGCAGCTATGCCTACGCCAGTCCAGAGATCCTCAAGGGCGTC
GCCTATGATCCTTTCATGTCGGACATCTGGGCCTGCGGCGTCGTCTGCTA
TGCGATGGTCTTTGGACGCCTTCCCTACGATGGCTCCAATGTGCACATCC
TGCTCAAGCGCATCAATCAATCGCTGGTCTTCCCCAAATCCCCATCAGCT
TCCAGCGAGTGCAAGCACATGATTATGCATATTCTAGCACCGGTGAAGAT
CAGGTACAATATTCCGCAGGTCAAGGAGGACCCTTGGTATTCGCCTAGCA
AATAGTTGCTACTCGTTTATGGTGCAGTGCAACAAAGCTGAAAAATTTCA
ACGTTTAGAACTAACAAATATTATAATTTTTCGATTCAAGTCAATAAATA
TATATTATTAGATTAGCAAAAAAAAAAAAAAAAAAA

AT03158.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG9222-RA 1323 CG9222-RA 53..1322 1..1270 6260 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6130335..6130740 180..585 2000 99.5 Plus
chr2L 23010047 chr2L 6131163..6131535 895..1267 1865 100 Plus
chr2L 23010047 chr2L 6130797..6131110 583..896 1525 99 Plus
chr2L 23010047 chr2L 6130097..6130277 1..181 890 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6131284..6131689 180..585 2000 99.5 Plus
2L 23513712 2L 6132112..6132487 895..1270 1880 100 Plus
2L 23513712 2L 6131746..6132059 583..896 1525 99 Plus
2L 23513712 2L 6131046..6131226 1..181 890 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6131284..6131689 180..585 2000 99.5 Plus
2L 23513712 2L 6132112..6132487 895..1270 1880 100 Plus
2L 23513712 2L 6131746..6132059 583..896 1525 99 Plus
2L 23513712 2L 6131046..6131226 1..181 890 99.4 Plus
Blast to na_te.dros performed 2019-03-16 22:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
transib4 2656 transib4 TRANSIB4 2656bp 2278..2329 1265..1215 113 71.2 Minus

AT03158.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:34:15 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6130799..6131109 585..895 99 -> Plus
chr2L 6130097..6130277 1..181 99 -> Plus
chr2L 6130337..6130739 182..584 99 -> Plus
chr2L 6131164..6131535 896..1267 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:50:25 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 1..1014 142..1155 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:43:38 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 1..1014 142..1155 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:11:40 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 1..1014 142..1155 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:12:00 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 1..1014 142..1155 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:48 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 1..1014 142..1155 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:08:13 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 24..1290 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:43:38 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 24..1290 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:11:40 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 24..1290 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:12:00 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 24..1290 1..1267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:40:48 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
CG9222-RA 24..1290 1..1267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:15 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6131046..6131226 1..181 99 -> Plus
2L 6131286..6131688 182..584 99 -> Plus
2L 6131748..6132058 585..895 99 -> Plus
2L 6132113..6132484 896..1267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:15 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6131046..6131226 1..181 99 -> Plus
2L 6131286..6131688 182..584 99 -> Plus
2L 6131748..6132058 585..895 99 -> Plus
2L 6132113..6132484 896..1267 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:15 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6131046..6131226 1..181 99 -> Plus
2L 6131286..6131688 182..584 99 -> Plus
2L 6131748..6132058 585..895 99 -> Plus
2L 6132113..6132484 896..1267 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:11:40 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6131046..6131226 1..181 99 -> Plus
arm_2L 6131286..6131688 182..584 99 -> Plus
arm_2L 6131748..6132058 585..895 99 -> Plus
arm_2L 6132113..6132484 896..1267 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:46:30 Download gff for AT03158.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6131286..6131688 182..584 99 -> Plus
2L 6131748..6132058 585..895 99 -> Plus
2L 6132113..6132484 896..1267 100   Plus
2L 6131046..6131226 1..181 99 -> Plus

AT03158.pep Sequence

Translation from 141 to 1154

> AT03158.pep
MATSPRRKNDQGGVIGASSSQDLVTDQNSGRRQEQKVYTFSDRPPQPKPP
APSGVVPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGK
RVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVY
LIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDI
KCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEIL
KGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKS
PSASSECKHMIMHILAPVKIRYNIPQVKEDPWYSPSK*

AT03158.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15399-PA 335 GF15399-PA 1..333 1..334 1628 93.1 Plus
Dana\GF17461-PA 1591 GF17461-PA 74..320 80..332 490 40 Plus
Dana\GF16910-PA 302 GF16910-PA 23..295 71..337 488 35.4 Plus
Dana\GF21982-PA 1480 GF21982-PA 144..393 80..335 471 41.1 Plus
Dana\GF12120-PA 692 GF12120-PA 43..293 78..334 460 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10392-PA 337 GG10392-PA 1..337 1..337 1687 96.4 Plus
Dere\GG22969-PA 302 GG22969-PA 23..290 71..332 490 36.1 Plus
Dere\GG17493-PA 1550 GG17493-PA 74..320 80..332 480 39.6 Plus
Dere\GG21978-PA 1223 GG21978-PA 498..746 78..332 471 39.6 Plus
Dere\GG21916-PA 699 GG21916-PA 43..293 78..334 464 40.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11008-PA 329 GH11008-PA 1..326 1..333 1557 86.2 Plus
Dgri\GH18350-PA 300 GH18350-PA 20..287 71..332 483 36.8 Plus
Dgri\GH19215-PA 308 GH19215-PA 21..288 71..332 481 36.3 Plus
Dgri\GH19123-PA 1414 GH19123-PA 80..326 80..332 478 39.6 Plus
Dgri\GH20038-PA 719 GH20038-PA 36..286 78..334 477 40.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9222-PA 337 CG9222-PA 1..337 1..337 1760 100 Plus
CG14305-PD 302 CG14305-PD 23..290 71..332 482 36.4 Plus
CG14305-PC 302 CG14305-PC 23..290 71..332 482 36.4 Plus
CG14305-PA 302 CG14305-PA 23..290 71..332 482 36.4 Plus
CG43143-PD 1180 CG11870-PD 49..295 53..305 471 39 Plus
CG43143-PG 1199 CG43143-PG 49..295 53..305 471 39 Plus
CG43143-PB 1427 CG11870-PB 49..295 53..305 471 39 Plus
CG43143-PC 1427 CG11870-PC 49..295 53..305 471 39 Plus
CG43143-PA 1427 CG11870-PA 49..295 53..305 471 39 Plus
CG43143-PF 1532 CG43143-PF 49..295 53..305 471 39 Plus
CG43143-PH 1551 CG43143-PH 49..295 53..305 471 39 Plus
CG43143-PE 2537 CG43143-PE 49..295 53..305 471 39 Plus
CG43143-PI 2556 CG43143-PI 49..295 53..305 471 39 Plus
Sik2-PA 1398 CG4290-PA 145..394 80..335 462 41.1 Plus
Sik3-PA 702 CG15072-PA 9..293 45..334 457 38.4 Plus
Sik3-PF 1379 CG42856-PF 9..293 45..334 457 38.4 Plus
Sik3-PE 1382 CG42856-PE 9..293 45..334 457 38.4 Plus
Sik3-PD 1468 CG42856-PD 9..293 45..334 457 38.4 Plus
Sik3-PC 1471 CG18604-PA 9..293 45..334 457 38.4 Plus
Sik3-PB 1471 CG15072-PB 9..293 45..334 457 38.4 Plus
par-1-PS 827 CG8201-PS 257..503 80..332 451 39.2 Plus
par-1-PW 832 CG8201-PW 257..503 80..332 451 39.2 Plus
par-1-PL 833 CG8201-PL 257..503 80..332 451 39.2 Plus
par-1-PA 938 CG8201-PA 257..503 80..332 451 39.2 Plus
par-1-PV 951 CG8201-PV 257..503 80..332 451 39.2 Plus
par-1-PH 993 CG8201-PH 380..626 80..332 451 39.2 Plus
par-1-PR 1046 CG8201-PR 485..731 80..332 451 39.2 Plus
par-1-PT 1058 CG8201-PT 485..731 80..332 451 39.2 Plus
par-1-PP 1141 CG8201-PP 485..731 80..332 451 39.2 Plus
par-1-PX 1170 CG8201-PX 257..503 80..332 451 39.2 Plus
KP78a-PB 705 CG6715-PB 102..348 80..332 445 39.2 Plus
KP78b-PB 604 CG17216-PB 67..313 80..332 439 39.2 Plus
KP78b-PA 604 CG17216-PA 67..313 80..332 439 39.2 Plus
AMPKalpha-PC 582 CG3051-PC 29..280 77..333 436 37.1 Plus
AMPKalpha-PB 582 CG3051-PB 29..280 77..333 436 37.1 Plus
AMPKalpha-PA 582 CG3051-PA 29..280 77..333 436 37.1 Plus
sff-PB 845 CG6114-PB 20..268 78..332 398 33.6 Plus
sff-PC 851 CG6114-PC 20..268 78..332 398 33.6 Plus
sff-PA 861 CG6114-PA 20..268 78..332 398 33.6 Plus
CG8485-PC 860 CG8485-PC 22..275 78..335 374 33.3 Plus
CG8485-PB 860 CG8485-PB 22..275 78..335 374 33.3 Plus
CG8485-PA 860 CG8485-PA 22..275 78..335 374 33.3 Plus
CG4629-PF 570 CG4629-PF 32..267 43..279 347 33.9 Plus
CG4629-PE 570 CG4629-PE 32..267 43..279 347 33.9 Plus
CaMKI-PI 390 CG1495-PI 14..288 59..334 326 30.3 Plus
aurA-PA 411 CG3068-PA 110..405 34..332 318 28.5 Plus
Akt1-PE 530 CG4006-PE 173..419 62..316 314 30.5 Plus
Akt1-PD 530 CG4006-PD 173..419 62..316 314 30.5 Plus
Akt1-PA 530 CG4006-PA 173..419 62..316 314 30.5 Plus
Akt1-PB 530 CG4006-PB 173..419 62..316 314 30.5 Plus
Akt1-PC 611 CG4006-PC 254..500 62..316 314 30.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17526-PA 329 GI17526-PA 1..327 1..334 1554 87.8 Plus
Dmoj\GI23333-PA 300 GI23333-PA 20..240 71..289 488 41 Plus
Dmoj\GI19215-PA 714 GI19215-PA 32..282 78..334 479 40.5 Plus
Dmoj\GI23579-PA 1495 GI23579-PA 73..319 80..332 479 39.2 Plus
Dmoj\GI20735-PA 1228 GI20735-PA 502..750 78..332 466 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19074-PA 141 GL19074-PA 1..141 1..143 573 79.7 Plus
Dper\GL23688-PA 1597 GL23688-PA 79..325 80..332 479 39.6 Plus
Dper\GL24355-PA 302 GL24355-PA 23..290 71..332 478 35.3 Plus
Dper\GL10531-PA 1212 GL10531-PA 440..734 49..332 466 37.3 Plus
Dper\GL10764-PA 617 GL10764-PA 49..299 78..334 465 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21624-PB 334 GA21624-PB 1..331 1..331 1532 86.8 Plus
Dpse\GA26704-PB 1439 GA26704-PB 79..325 80..332 479 39.6 Plus
Dpse\GA22494-PA 1468 GA22494-PA 79..325 80..332 479 39.6 Plus
Dpse\GA12894-PA 302 GA12894-PA 23..290 71..332 478 35.3 Plus
Dpse\GA26704-PC 1033 GA26704-PC 79..325 80..332 478 39.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18607-PA 337 GM18607-PA 1..337 1..337 1784 98.8 Plus
Dsec\GM17875-PA 302 GM17875-PA 23..290 71..332 496 36.8 Plus
Dsec\GM23873-PA 1565 GM23873-PA 70..316 80..332 487 40 Plus
Dsec\GM18924-PA 1329 GM18924-PA 149..398 80..335 468 41.1 Plus
Dsec\GM26105-PA 603 GM26105-PA 67..313 80..332 457 40.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23390-PA 337 GD23390-PA 1..337 1..337 1780 98.5 Plus
Dsim\GD19235-PA 302 GD19235-PA 23..290 71..332 494 36.4 Plus
Dsim\GD18682-PA 1567 GD18682-PA 70..316 80..332 487 40 Plus
Dsim\GD20665-PA 603 GD20665-PA 67..313 80..332 456 39.8 Plus
Dsim\GD16554-PA 582 GD16554-PA 29..280 77..333 447 37.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15400-PA 329 GJ15400-PA 1..326 1..333 1580 87.7 Plus
Dvir\GJ23554-PA 1365 GJ23554-PA 73..319 80..332 484 39.6 Plus
Dvir\GJ10334-PA 300 GJ10334-PA 20..240 71..289 483 40.5 Plus
Dvir\GJ10823-PA 318 GJ10823-PA 21..241 71..289 483 40.5 Plus
Dvir\GJ20287-PA 715 GJ20287-PA 32..282 78..334 478 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15382-PA 327 GK15382-PA 1..325 1..334 1587 88.3 Plus
Dwil\GK13092-PA 316 GK13092-PA 24..296 71..336 489 35.4 Plus
Dwil\GK12830-PA 2853 GK12830-PA 82..328 80..332 481 39.6 Plus
Dwil\GK20917-PA 755 GK20917-PA 51..301 78..334 464 39.8 Plus
Dwil\GK11799-PA 719 GK11799-PA 119..365 80..332 462 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13670-PA 336 GE13670-PA 1..336 1..337 1727 96.7 Plus
Dyak\GE25543-PA 302 GE25543-PA 23..290 71..332 490 36.1 Plus
Dyak\GE26024-PA 1476 GE26024-PA 79..325 80..332 487 40 Plus
Dyak\GE24628-PA 600 GE24628-PA 67..313 80..332 464 40.2 Plus
Dyak\GE11992-PA 704 GE11992-PA 43..293 78..334 462 40.5 Plus

AT03158.hyp Sequence

Translation from 141 to 1154

> AT03158.hyp
MATSPRRKNDQGGVIGASSSQDLVTDQNSGRRQEQKVYTFSDRPPQPKPP
APSGVVPVKADDKSKPQKTILEEHGIILGKVIGTGNYAKVKIGFSEEYGK
RVAVKIISKVKAPSEYTQKFLPREIEAVKGLHHENLITFYQSIETSHRVY
LIMQLAENGTLLDYVRERKFLDEPQSRTLFKQLVSAVEYIHSKGVVHRDI
KCENLLLDENWNLKLIDFGFARKDTRTSDNQVILSKTFCGSYAYASPEIL
KGVAYDPFMSDIWACGVVCYAMVFGRLPYDGSNVHILLKRINQSLVFPKS
PSASSECKHMIMHILAPVKIRYNIPQVKEDPWYSPSK*

AT03158.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9222-PA 337 CG9222-PA 1..337 1..337 1760 100 Plus
CG14305-PD 302 CG14305-PD 23..290 71..332 482 36.4 Plus
CG14305-PC 302 CG14305-PC 23..290 71..332 482 36.4 Plus
CG14305-PA 302 CG14305-PA 23..290 71..332 482 36.4 Plus
CG43143-PD 1180 CG11870-PD 49..295 53..305 471 39 Plus