Clone AT03272 Report

Search the DGRC for AT03272

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:32
Well:72
Vector:pOTB7
Associated Gene/TranscriptNmnat-RA
Protein status:AT03272.pep: gold
Sequenced Size:1304

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Nmnat 2008-04-29 Release 5.5 accounting
Nmnat 2008-04-29 Picked prior to 5.5
Nmnat 2008-08-15 Release 5.9 accounting
Nmnat 2008-12-18 5.12 accounting

Clone Sequence Records

AT03272.complete Sequence

1304 bp assembled on 2007-09-24

GenBank Submission: BT030750

> AT03272.complete
AATAACAACAAGCCGAACAGATGATTGTGAAAATCAGCTGGCCCAAGAAC
AACATAACAAGCGAATGCTTCCGGCGGTTTGGATCTTTTAAAAGACGCTC
AAAATCGAAGAAAATGTCAGCATTCATCGAGGAAACAAAAAGCCTGCTGC
CGCGGATCGCCTTCATAGCCTGCGGATGCTTCAGTCCACCCACACCCATG
CACCTTCGGATGTTCGAGATAGCCAAGGACCACTTCGAAATGCAGGGAAC
CCACAGAGTGGTAGGTGGCATCATCTCGCCCACGCACGACTCATATGGCA
AAAAGGGTCTGGCCTCCGCCTTGGACAGATGTGCCATGGTCAAGCTGGCC
ACCCAGAGCTCCAATTGGATTCGGTTGTCCGATTGGGAGGTGCACCAGAA
TCAGTGGATGCGCACGCAGGCGGTGCTCCAGCACCACCAGAACTATATCA
ATAACCACATAAATTCCGGCGGGGGAGGCGGAGATGACGGGGAGAACACA
CATCTACCCGGATGGCTGCCTCGTGGGTTGCACGACAGTCGGGATCCTGT
ACATCTGAAGCTACTGTGCGGTGCCGATCTGCTGGAGTCCTTTGCTGTTC
CAGGCCTATGGGCAGAGGCCGATATTGAGGACATTGTGGCTAACCATGGT
TTGGTAGTTATCACCCGGGCCGGCTCAAACCCAGGAAAATTCATCTTTGA
CTCCGACATATTGACCAAGTATCAGAGCAACATTACGCTAATCACCAACT
GGGTGCCTAATGAGGTGAGCTCCACGTTGATTCGGCGGCTCTTAGGACGC
GGCCAGTCGGTCAAGTACCTTCTAGACGATCTGGTGCTGGAGTACATCAA
GCGCCAACGATTGTTTAACTTTAAATCTAAGTATATAACGGATGCGGTGC
GTCCCAACCATTTGCTCTTTAACCACGCCTATACGGACAACAACAAGAAC
GCGAACAGCTACTCTATAGGCGACCAGCTGGAGCAGGACATGGACGAGTC
GGACACTCCAAGCCCGCAACTGCAGCATACGCCTACGTCGCGGGTTTTCT
GCTGCGGGGAGGTGCCTTTACGTGGATCCAAGGTGCTGCGATCCGGTCCT
GGACAAGCGGTGCAGGTCATCACCATGCAGGCAGATGAGAAAGAGGAGAG
CCAAGCAAAGAAGCAGAAGATTTCCCAAGTGCAACTTTAGGAAACTGGAA
GACGAATCTCACGCGGATTAAGACAGGGGCGCTGGAAGCTATTTGTTGAT
ATTATATAAATATGCAAAATAAACACGTTCGTTACCAAAAAAAAAAAAAA
AAAA

AT03272.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Nmnat.a 1410 Nmnat.a 120..1407 1..1288 6440 100 Plus
Nmnat-RA 1392 Nmnat-RA 102..1389 1..1288 6440 100 Plus
Nmnat.b 947 Nmnat.b 2..878 1..877 4385 100 Plus
Nmnat.b 947 Nmnat.b 879..947 948..1016 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20768711..20769118 216..623 2040 100 Plus
chr3R 27901430 chr3R 20770070..20770340 878..1148 1355 100 Plus
chr3R 27901430 chr3R 20768424..20768639 1..216 1080 100 Plus
chr3R 27901430 chr3R 20769326..20769481 722..877 780 100 Plus
chr3R 27901430 chr3R 20770447..20770586 1147..1286 700 100 Plus
chr3R 27901430 chr3R 20769170..20769271 624..725 510 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:38:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24945525..24945932 216..623 2040 100 Plus
3R 32079331 3R 24946884..24947154 878..1148 1355 100 Plus
3R 32079331 3R 24945238..24945453 1..216 1080 100 Plus
3R 32079331 3R 24946140..24946295 722..877 780 100 Plus
3R 32079331 3R 24947261..24947402 1147..1288 710 100 Plus
3R 32079331 3R 24945984..24946085 624..725 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24686356..24686763 216..623 2040 100 Plus
3R 31820162 3R 24687715..24687985 878..1148 1355 100 Plus
3R 31820162 3R 24686069..24686284 1..216 1080 100 Plus
3R 31820162 3R 24686971..24687126 722..877 780 100 Plus
3R 31820162 3R 24688092..24688233 1147..1288 710 100 Plus
3R 31820162 3R 24686815..24686916 624..725 510 100 Plus
Blast to na_te.dros performed on 2019-03-15 11:30:23 has no hits.

AT03272.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:31:23 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20769170..20769271 624..725 100 -> Plus
chr3R 20769330..20769481 726..877 100 -> Plus
chr3R 20770070..20770340 878..1148 100 -> Plus
chr3R 20770449..20770586 1149..1286 100   Plus
chr3R 20768424..20768639 1..216 100 -> Plus
chr3R 20768712..20769118 217..623 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:50:46 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 1..1170 21..1190 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:48 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 1..1170 21..1190 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:30:14 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 1..1170 21..1190 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:46:15 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 1..1170 21..1190 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:36:55 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 1..1170 21..1190 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:42:51 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 2..1287 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:47 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 2..1287 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:30:14 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 2..1287 1..1286 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:46:15 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 2..1287 1..1286 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:36:55 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
Nmnat-RA 2..1287 1..1286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:23 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24945238..24945453 1..216 100 -> Plus
3R 24945526..24945932 217..623 100 -> Plus
3R 24945984..24946085 624..725 100 -> Plus
3R 24946144..24946295 726..877 100 -> Plus
3R 24946884..24947154 878..1148 100 -> Plus
3R 24947263..24947400 1149..1286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:23 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24945238..24945453 1..216 100 -> Plus
3R 24945526..24945932 217..623 100 -> Plus
3R 24945984..24946085 624..725 100 -> Plus
3R 24946144..24946295 726..877 100 -> Plus
3R 24946884..24947154 878..1148 100 -> Plus
3R 24947263..24947400 1149..1286 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:31:23 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24945238..24945453 1..216 100 -> Plus
3R 24945526..24945932 217..623 100 -> Plus
3R 24945984..24946085 624..725 100 -> Plus
3R 24946144..24946295 726..877 100 -> Plus
3R 24946884..24947154 878..1148 100 -> Plus
3R 24947263..24947400 1149..1286 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:30:14 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20770960..20771175 1..216 100 -> Plus
arm_3R 20771248..20771654 217..623 100 -> Plus
arm_3R 20771706..20771807 624..725 100 -> Plus
arm_3R 20771866..20772017 726..877 100 -> Plus
arm_3R 20772606..20772876 878..1148 100 -> Plus
arm_3R 20772985..20773122 1149..1286 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:41 Download gff for AT03272.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24686357..24686763 217..623 100 -> Plus
3R 24686815..24686916 624..725 100 -> Plus
3R 24686975..24687126 726..877 100 -> Plus
3R 24687715..24687985 878..1148 100 -> Plus
3R 24688094..24688231 1149..1286 100   Plus
3R 24686069..24686284 1..216 100 -> Plus

AT03272.hyp Sequence

Translation from 20 to 1189

> AT03272.hyp
MIVKISWPKNNITSECFRRFGSFKRRSKSKKMSAFIEETKSLLPRIAFIA
CGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASA
LDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSG
GGGGDDGENTHLPGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEA
DIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVS
STLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSKYITDAVRPNHLLF
NHAYTDNNKNANSYSIGDQLEQDMDESDTPSPQLQHTPTSRVFCCGEVPL
RGSKVLRSGPGQAVQVITMQADEKEESQAKKQKISQVQL*

AT03272.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:46:57
Subject Length Description Subject Range Query Range Score Percent Strand
Nmnat-PA 389 CG13645-PA 1..389 1..389 2061 100 Plus
Nmnat-PC 358 CG13645-PC 1..358 32..389 1897 100 Plus
Nmnat-PB 297 CG13645-PB 1..287 1..287 1526 99.7 Plus

AT03272.pep Sequence

Translation from 20 to 1189

> AT03272.pep
MIVKISWPKNNITSECFRRFGSFKRRSKSKKMSAFIEETKSLLPRIAFIA
CGCFSPPTPMHLRMFEIAKDHFEMQGTHRVVGGIISPTHDSYGKKGLASA
LDRCAMVKLATQSSNWIRLSDWEVHQNQWMRTQAVLQHHQNYINNHINSG
GGGGDDGENTHLPGWLPRGLHDSRDPVHLKLLCGADLLESFAVPGLWAEA
DIEDIVANHGLVVITRAGSNPGKFIFDSDILTKYQSNITLITNWVPNEVS
STLIRRLLGRGQSVKYLLDDLVLEYIKRQRLFNFKSKYITDAVRPNHLLF
NHAYTDNNKNANSYSIGDQLEQDMDESDTPSPQLQHTPTSRVFCCGEVPL
RGSKVLRSGPGQAVQVITMQADEKEESQAKKQKISQVQL*

AT03272.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16316-PA 359 GF16316-PA 1..359 32..389 1664 85.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:32:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11340-PA 297 GG11340-PA 1..287 1..287 1474 95.1 Plus
Dere\GG11341-PA 99 GG11341-PA 3..99 293..389 502 95.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:32:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19439-PA 346 GH19439-PA 1..344 42..388 1332 71.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
Nmnat-PA 389 CG13645-PA 1..389 1..389 2061 100 Plus
Nmnat-PC 358 CG13645-PC 1..358 32..389 1897 100 Plus
Nmnat-PB 297 CG13645-PB 1..287 1..287 1526 99.7 Plus
Nmnat-PD 266 CG13645-PD 1..256 32..287 1362 99.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22219-PA 358 GI22219-PA 1..356 32..388 1365 72.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:32:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24404-PA 266 GL24404-PA 1..256 32..287 1179 84 Plus
Dper\GL20613-PA 65 GL20613-PA 1..65 324..389 250 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30135-PA 354 GA30135-PA 1..354 32..389 1586 82.1 Plus
Dpse\GA30135-PB 266 GA30135-PB 1..256 32..287 1180 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:32:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26649-PA 323 GM26649-PA 14..323 79..389 1528 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21151-PA 297 GD21151-PA 1..287 1..287 1517 97.2 Plus
Dsim\GD21152-PA 99 GD21152-PA 3..99 293..389 514 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24340-PA 359 GJ24340-PA 1..357 32..388 1357 73.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:33:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12977-PA 356 GK12977-PA 1..356 32..389 1417 74.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23535-PA 266 GE23535-PA 1..262 32..296 1348 94.7 Plus
Dyak\GE23536-PA 99 GE23536-PA 3..99 293..389 496 94.8 Plus