Clone AT03311 Report

Search the DGRC for AT03311

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:33
Well:11
Vector:pOTB7
Associated Gene/TranscriptCG18223-RC
Protein status:AT03311.pep: gold
Preliminary Size:528
Sequenced Size:1016

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18223 2002-01-01 Sim4 clustering to Release 2
CG18223 2002-02-27 Blastp of sequenced clone
CG18223 2003-01-01 Sim4 clustering to Release 3
CG18223 2008-04-29 Release 5.5 accounting
CG18223 2008-08-15 Release 5.9 accounting
CG18223 2008-12-18 5.12 accounting

Clone Sequence Records

AT03311.complete Sequence

1016 bp (1016 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084093

> AT03311.complete
CAATGTTGCTACTGAAATATGGAGTATCTAGGAAAATCTTCAGTTTCCTA
CTGTTCCTCTTGTTGCTTCTGCCGATCCTTGACGCCGGTGATCCGATTGG
CAGCCACTTCGTCCGCCGGCGGGCTAAACGCCTTTCCAGTCCCTATTTCG
ACAAGGAAAAAACGTTGGTTCTGGCCAAATATGTAGTCTCGATTCGATCC
CGAAGACCCCACAAGTTATTTGGCGACAATCACTTCTGCGGTGGCGTGAT
CATATCGAGAACCTACATCCTCACCTCCGCCCACTGCGCCATGGAGTAGT
AAGCGCAAGATCGTACATCGCAGTCGGGTGTTGGTGGTTGTGGCTGGAAC
CACAAATCGTCTGAAATCCCGCAAAGGACTCTCTTTAAACATGGAGGTGA
AGAAGATCTTTGTCCCAGACAAGTTCACAGTATTCAATACGAACAACATT
GCGCTGATGATGCTGGCCAAAAAACTACCCTTGGACAATCCGCTTGTGGG
TGTGATCAATCTGCCTACGGCTGACCCAGAACCGGGTTTGAACTACACGG
TGCTGGGCTGGGGAAGGATCTTCAAGGTAAGTTGTGGTAGTTACGAACTA
TAAGTAGGTTTATTATTAACTATAGGGCGGTCCCCTGGCCTCGGACATCC
TGCACATTGACGTGGAGCTATTGCCCCGGGATATCTGTGAGAAGAAAGTC
CACATCTTCAAGGAGGAGATGATGTGCGCCGGAAATCTGAACAACACCAT
GGACGAGAATCCCTGTGCCGGTGACACCGGAAGCCCACTGATTTTCAACG
AAACAGTCTTTGGTGTGGTTAGCTACCGAGTAGGCTGTGGATCTAAAACT
TTGCCCTCCATTTATACCAACGTCTACATGCATATGGACTGGATTAATGG
CATTATGAACAATAATGAAGCGAACCGATTGTGTTACTCTCCCAACTATC
TATTCACCACCATTGGTATAATCATTGGAAATAAAATTCTGAAAAGTTAA
AAAAAAAAAAAAAAAA

AT03311.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
nc_13403.a 998 nc_13403.a 1..998 1..998 4990 100 Plus
CG18223-RB 1011 CG18223-RB 18..1011 1..998 4905 99.5 Plus
CG18223-RA 1014 CG18223-RA 44..616 1..577 2800 99.3 Plus
CG18223-RA 1014 CG18223-RA 614..988 624..998 1875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18908878..18909578 998..298 3490 99.9 Minus
chr3L 24539361 chr3L 18909632..18909930 299..1 1495 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18919250..18919950 998..298 3505 100 Minus
3L 28110227 3L 18920004..18920302 299..1 1495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18912350..18913050 998..298 3505 100 Minus
3L 28103327 3L 18913104..18913402 299..1 1495 100 Minus
Blast to na_te.dros performed 2019-03-15 15:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 2102..2171 109..44 124 68.6 Minus

AT03311.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:16:07 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18908878..18909576 300..998 99 <- Minus
chr3L 18909632..18909930 1..299 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:50:49 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..597 3..603 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:33:36 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..597 3..603 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:09:44 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RA 577..943 632..998 100   Plus
CG18223-RA 1..576 3..582 98 == Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:06:02 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..597 3..603 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:29 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RA 577..943 632..998 100   Plus
CG18223-RA 1..576 3..582 98 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:59:28 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..994 1..998 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:33:36 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..994 1..998 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:09:44 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RC 18..599 1..582 99 == Plus
CG18223-RC 600..966 632..998 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:06:02 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RB 1..994 1..998 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:29 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
CG18223-RC 18..599 1..582 99 == Plus
CG18223-RC 600..966 632..998 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:07 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18919250..18919948 300..998 100 <- Minus
3L 18920004..18920302 1..299 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:07 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18919250..18919948 300..998 100 <- Minus
3L 18920004..18920302 1..299 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:16:07 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18919250..18919948 300..998 100 <- Minus
3L 18920004..18920302 1..299 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:09:44 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18912350..18913048 300..998 100 <- Minus
arm_3L 18913104..18913402 1..299 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:39:52 Download gff for AT03311.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18912350..18913048 300..998 100 <- Minus
3L 18913104..18913402 1..299 100   Minus

AT03311.pep Sequence

Translation from 2 to 298

> AT03311.pep
MLLLKYGVSRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFD
KEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAME*

AT03311.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10797-PA 335 GF10797-PA 25..92 31..98 234 60.3 Plus
Dana\GF10796-PA 312 GF10796-PA 9..93 15..97 172 47.7 Plus
Dana\GF24742-PA 310 GF24742-PA 63..104 57..98 137 59.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13441-PA 322 GG13441-PA 1..98 1..98 426 91.8 Plus
Dere\GG22790-PA 270 GG22790-PA 1..49 49..97 178 63.3 Plus
Dere\GG14382-PA 304 GG14382-PA 35..89 40..95 162 55.4 Plus
Dere\GG12685-PA 308 GG12685-PA 52..90 57..95 145 61.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16532-PA 301 GH16532-PA 28..87 39..98 198 60 Plus
Dgri\GH19781-PA 275 GH19781-PA 11..66 42..98 180 61.4 Plus
Dgri\GH24443-PA 308 GH24443-PA 60..98 57..95 151 61.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG18223-PC 98 CG18223-PC 1..98 1..98 501 100 Plus
CG18223-PA 322 CG18223-PA 1..98 1..98 498 99 Plus
CG13527-PA 290 CG13527-PA 7..80 15..97 205 50.6 Plus
CG13527-PB 292 CG13527-PB 7..80 15..97 205 50.6 Plus
CG4477-PB 315 CG4477-PB 7..88 15..95 169 44.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20322-PA 292 GI20322-PA 25..85 38..98 204 55.7 Plus
Dmoj\GI12048-PA 308 GI12048-PA 3..96 4..97 187 44.7 Plus
Dmoj\GI20323-PA 308 GI20323-PA 32..91 37..97 176 55.7 Plus
Dmoj\GI16031-PA 363 GI16031-PA 113..153 57..97 161 63.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22039-PA 295 GL22039-PA 3..85 9..98 210 48.9 Plus
Dper\GL11375-PA 277 GL11375-PA 12..71 38..98 200 60.7 Plus
Dper\GL14363-PA 313 GL14363-PA 60..98 57..95 148 64.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14844-PA 295 GA14844-PA 3..85 9..98 209 48.9 Plus
Dpse\GA24700-PA 277 GA24700-PA 11..71 37..98 201 59.7 Plus
Dpse\GA22993-PA 313 GA22993-PA 60..98 57..95 148 64.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14910-PA 322 GM14910-PA 1..98 1..98 411 95.9 Plus
Dsec\GM15948-PA 281 GM15948-PA 9..66 40..97 211 63.8 Plus
Dsec\GM25124-PA 315 GM25124-PA 1..91 8..98 170 42.4 Plus
Dsec\GM18957-PA 239 GM18957-PA 51..95 51..95 135 55.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12317-PA 244 GD12317-PA 1..98 1..98 493 96.9 Plus
Dsim\GD11702-PA 281 GD11702-PA 9..66 40..97 210 63.8 Plus
Dsim\GD14161-PA 316 GD14161-PA 9..92 16..98 169 44.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22047-PA 292 GJ22047-PA 27..86 39..98 211 63.3 Plus
Dvir\GJ13318-PA 307 GJ13318-PA 21..88 33..98 195 57.4 Plus
Dvir\GJ22048-PA 299 GJ22048-PA 31..87 40..97 170 53.4 Plus
Dvir\GJ15542-PA 304 GJ15542-PA 54..92 57..95 141 59 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10389-PA 307 GK10389-PA 6..93 13..98 249 57.3 Plus
Dwil\GK21453-PA 299 GK21453-PA 30..90 38..98 231 65.6 Plus
Dwil\GK25304-PA 337 GK25304-PA 35..118 31..98 150 40.5 Plus
Dwil\GK11985-PA 283 GK11985-PA 6..72 38..95 137 44.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22539-PA 322 GE22539-PA 1..98 1..98 421 91.8 Plus
Dyak\GE14020-PA 285 GE14020-PA 9..66 40..97 201 62.1 Plus
Dyak\GE20812-PA 318 GE20812-PA 34..89 39..95 165 54.4 Plus

AT03311.hyp Sequence

Translation from 2 to 298

> AT03311.hyp
MLLLKYGVSRKIFSFLLFLLLLLPILDAGDPIGSHFVRRRAKRLSSPYFD
KEKTLVLAKYVVSIRSRRPHKLFGDNHFCGGVIISRTYILTSAHCAME*

AT03311.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG18223-PC 98 CG18223-PC 1..98 1..98 501 100 Plus
CG18223-PA 322 CG18223-PA 1..98 1..98 498 99 Plus
CG13527-PA 290 CG13527-PA 7..80 15..97 205 50.6 Plus
CG13527-PB 292 CG13527-PB 7..80 15..97 205 50.6 Plus
CG4477-PB 315 CG4477-PB 7..88 15..95 169 44.6 Plus