Clone AT03531 Report

Search the DGRC for AT03531

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:35
Well:31
Vector:pOTB7
Associated Gene/TranscriptCG15498-RA
Protein status:AT03531.pep: gold
Preliminary Size:774
Sequenced Size:1185

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15498 2002-01-01 Sim4 clustering to Release 2
CG15498 2002-03-20 Blastp of sequenced clone
CG15498 2003-01-01 Sim4 clustering to Release 3
CG15498 2008-04-29 Release 5.5 accounting
CG15498 2008-08-15 Release 5.9 accounting
CG15498 2008-12-18 5.12 accounting

Clone Sequence Records

AT03531.complete Sequence

1185 bp (1185 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094632

> AT03531.complete
GGTGGTTGCCGGGTTGTCACTAGGAAACCAGAGCACACGACAAGCAAACA
CCACCGGCGACACTGGACGGACTGATTAGGTAACTGGATATGCTCCCAAC
ATCCCAAATAACTACAGAGCAATGTATGGTCCTGGGGTGAAAGTGGGTAA
CTGGCTGGAAACTGCCTTGTCGGAGGAGATGCGTATGAGTGAAATGAAGA
AGCGTCGGGAGAGCGGTAACCTGCTGCTGGACAGGACCCGTGCCGTCTAC
GACCGCTTCTACCAGGGAACAGTGCTGGGTCCGCCGCAGGATGTTCTGGC
CTTCGGCGTGGTGGTCCAGATCCGGCCCGTGAAGATCGGTGTCTGCCGCC
AACAGGTTTCGGATCAGAACCTGGTGCTTTCGGTGGTAATTACTCAGGAG
GGACTGCATCGCAACTGCAAGACCATCAACGAGATGTGTGATCTTACGGT
GGCACCTTCGCCGCGTCCCGCGTTGCGCAACAGCTTCAGAATCGTCAGTC
CGAACGAGGATGACCGTACCGGTCAGTATCTGGCCTACGGCGAGAAGTTC
CGCCTGCAAGCCCTGGAGCCTGCTGATGAGCCTATGTATGTTTTCAGCGG
TCCCAAGAGGCTGAACCTCTCGCTTCCCGTGGAGAAGGCGTTCTTTACAA
CCAAAAACGGCGAGGTTACACTTCCACTCGGCTTAGTGTCCCATAAGAAT
TGTGGCCCCTCTGCCCGTGTGCCCACTTCGCACACTCACTTCTTCTGCGC
CCACAAGGATCCCGATCTTCGATTCGAAAGCGAAGGCAAGACCATACCAG
TACACAATCCGCTTGTCATTGTTCACGCGGTTACCAATCGAAATTTGGCT
GTGGAGAATGTTTTGGCCAACACCTTGTTTGGCCCCGAGTTCCAGGTGTC
CGTGCAGACGTACAAGAATGTGTACAAGCGCGAGACATGGAAGAACCTGT
GGAAGTTCACATATTGATATGGGTCGTTCCATAAGTCGGCGTATTTTCAG
ATTTTTTTATGTTATATTATATAGTTTCAGTTTGGTTATGGCTCGGTACC
TGCTGTGGCATCCAAACGACCCAATCAAATGAGCTGTTGCAAGTTTGCCT
GTTTGTTCTCAGCATGTCAAAATAAAAGACTAGACGAGAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT03531.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15498-RA 1206 CG15498-RA 58..1198 1..1140 5650 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17392035..17392555 697..177 2590 99.8 Minus
chr3R 27901430 chr3R 17391211..17391550 1138..800 1620 99.1 Minus
chr3R 27901430 chr3R 17392675..17392852 178..1 890 100 Minus
chr3R 27901430 chr3R 17391872..17391978 802..696 520 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21568332..21568852 697..177 2605 100 Minus
3R 32079331 3R 21567517..21567858 1140..800 1660 99.7 Minus
3R 32079331 3R 21568972..21569149 178..1 890 100 Minus
3R 32079331 3R 21568169..21568275 802..696 520 99.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21309163..21309683 697..177 2605 100 Minus
3R 31820162 3R 21308348..21308689 1140..800 1670 99.7 Minus
3R 31820162 3R 21309803..21309980 178..1 890 100 Minus
3R 31820162 3R 21309000..21309106 802..696 520 99 Minus
Blast to na_te.dros performed on 2019-03-16 06:01:25 has no hits.

AT03531.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:02:32 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17391211..17391550 800..1138 99 <- Minus
chr3R 17391875..17391976 698..799 99 <- Minus
chr3R 17392035..17392553 179..697 99 <- Minus
chr3R 17392675..17392852 1..178 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:51:06 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..846 122..967 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:27:30 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..846 122..967 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:23:29 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..846 122..967 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:02:21 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..846 122..967 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:13:10 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..846 122..967 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:54:06 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..1139 1..1138 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:27:30 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..1139 1..1138 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:23:29 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..1139 1..1138 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:02:21 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..1139 1..1138 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:13:10 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
CG15498-RA 1..1139 1..1138 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:32 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21567519..21567858 800..1138 99 <- Minus
3R 21568172..21568273 698..799 99 <- Minus
3R 21568332..21568850 179..697 100 <- Minus
3R 21568972..21569149 1..178 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:32 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21567519..21567858 800..1138 99 <- Minus
3R 21568172..21568273 698..799 99 <- Minus
3R 21568332..21568850 179..697 100 <- Minus
3R 21568972..21569149 1..178 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:02:32 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21567519..21567858 800..1138 99 <- Minus
3R 21568172..21568273 698..799 99 <- Minus
3R 21568332..21568850 179..697 100 <- Minus
3R 21568972..21569149 1..178 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:29 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17393241..17393580 800..1138 99 <- Minus
arm_3R 17393894..17393995 698..799 99 <- Minus
arm_3R 17394054..17394572 179..697 100 <- Minus
arm_3R 17394694..17394871 1..178 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:35:37 Download gff for AT03531.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21308350..21308689 800..1138 99 <- Minus
3R 21309003..21309104 698..799 99 <- Minus
3R 21309163..21309681 179..697 100 <- Minus
3R 21309803..21309980 1..178 100   Minus

AT03531.pep Sequence

Translation from 121 to 966

> AT03531.pep
MYGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGT
VLGPPQDVLAFGVVVQIRPVKIGVCRQQVSDQNLVLSVVITQEGLHRNCK
TINEMCDLTVAPSPRPALRNSFRIVSPNEDDRTGQYLAYGEKFRLQALEP
ADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSARV
PTSHTHFFCAHKDPDLRFESEGKTIPVHNPLVIVHAVTNRNLAVENVLAN
TLFGPEFQVSVQTYKNVYKRETWKNLWKFTY*

AT03531.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16413-PA 282 GF16413-PA 3..282 1..281 1126 71.9 Plus
Dana\GF11401-PA 310 GF11401-PA 15..293 2..280 731 47.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:00:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14451-PA 281 GG14451-PA 1..281 1..281 1427 94 Plus
Dere\GG20621-PA 558 GG20621-PA 15..288 2..275 720 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:00:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23078-PA 302 GH23078-PA 15..293 2..280 720 48.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15498-PA 281 CG15498-PA 1..281 1..281 1484 100 Plus
CG34457-PB 308 CG34457-PB 15..290 2..277 701 47.3 Plus
CG34457-PA 308 CG34457-PA 15..290 2..277 701 47.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21147-PA 303 GI21147-PA 15..293 2..280 704 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:00:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11792-PA 305 GL11792-PA 15..293 2..280 739 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:00:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24075-PA 305 GA24075-PA 15..293 2..280 732 47.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11003-PA 249 GM11003-PA 1..249 1..281 1283 86.5 Plus
Dsec\GM21716-PA 404 GM21716-PA 8..281 2..275 713 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:00:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19973-PA 281 GD19973-PA 1..281 1..281 1497 98.2 Plus
Dsim\GD11212-PA 551 GD11212-PA 8..281 2..275 713 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20995-PA 302 GJ20995-PA 15..293 2..280 706 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14258-PA 290 GK14258-PA 6..287 2..281 872 56.7 Plus
Dwil\GK10655-PA 303 GK10655-PA 15..292 2..280 707 45.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24971-PA 281 GE24971-PA 1..281 1..281 1466 96.4 Plus
Dyak\GE11062-PA 262 GE11062-PA 1..262 20..281 1362 96.2 Plus
Dyak\GE11811-PA 560 GE11811-PA 15..288 2..275 717 48.9 Plus

AT03531.hyp Sequence

Translation from 121 to 966

> AT03531.hyp
MYGPGVKVGNWLETALSEEMRMSEMKKRRESGNLLLDRTRAVYDRFYQGT
VLGPPQDVLAFGVVVQIRPVKIGVCRQQVSDQNLVLSVVITQEGLHRNCK
TINEMCDLTVAPSPRPALRNSFRIVSPNEDDRTGQYLAYGEKFRLQALEP
ADEPMYVFSGPKRLNLSLPVEKAFFTTKNGEVTLPLGLVSHKNCGPSARV
PTSHTHFFCAHKDPDLRFESEGKTIPVHNPLVIVHAVTNRNLAVENVLAN
TLFGPEFQVSVQTYKNVYKRETWKNLWKFTY*

AT03531.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15498-PA 281 CG15498-PA 1..281 1..281 1484 100 Plus
CG34457-PB 308 CG34457-PB 15..290 2..277 701 47.3 Plus
CG34457-PA 308 CG34457-PA 15..290 2..277 701 47.3 Plus