BDGP Sequence Production Resources |
Search the DGRC for AT03573
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 35 |
Well: | 73 |
Vector: | pOTB7 |
Associated Gene/Transcript | lectin-46Cb-RB |
Protein status: | AT03573.pep: gold |
Preliminary Size: | 973 |
Sequenced Size: | 1057 |
Gene | Date | Evidence |
---|---|---|
CG1652 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1652 | 2002-02-22 | Blastp of sequenced clone |
CG1652 | 2003-01-01 | Sim4 clustering to Release 3 |
lectin-46Cb | 2008-04-29 | Release 5.5 accounting |
lectin-46Cb | 2008-08-15 | Release 5.9 accounting |
lectin-46Cb | 2008-12-18 | 5.12 accounting |
1057 bp (1057 high quality bases) assembled on 2002-02-22
GenBank Submission: AY089249
> AT03573.complete GCGAAATGAAGCATCTCCTGACTGCACTCGTGGCCCTGCTGAGCATCCTG CCGCGGGGCGAGCTCCTGGGATCAGGACCCCCCTGCCCGCGTCGCTATTT GCGCAGGATCAACGGCAAGTGCTACTACTTTTCGGTGAAAAAGATGAACT GGTTTGGCGCCCTGAACAACTGCCTACGCAAAGGACTGACCCTGGCAGAC TTGAGCAACCAAAGGGACTTCGACGGAGCCATTGGGTTCCTGAGTGGCCT GGGCAACACGGAGGATTTCTGGTTCGGGGGCAACGATCTGTATCACGAGG GTCGTTTCCAGTACATCAGCAACGGTCGGTTGGTGCGCTACTACAGCAAC TATAGCAACGTCCTGCCACTGGAGCACTCCGAGTGCGACGACTGCCTGGA GGTGAGGATCCGCTCCGAGATCAACATGGTGTCGGCAGACAACTGCCACG AGCGGCAATACTTCATCTGCTCGGAACGCTACTGCCAGGGCACGGATAGT GGCAAGAAGCCGAAGCACCACAGTCACGAGCACTTGCATCACTTCCACCA CGACATTGGCGGAAGTGCCGAAGGAGAGGACGATGGCGATGGCGATGGCG ACCACGACCGCCAGGACCCCATTGCCAGTGGCTCAGTGGAGCACCCGGAG CCGGACTCGGAGGATGCAGTCGGGGCGCTCGACGTGCCCGATGACGATCA ACCTGGTCAGAATGGCGTCTCGGTGACACCGGGAGCGGAAGAAACAAATA CCGTTGGCGGAACTGGTGAGCCGGGCGCAACTGCCACCCCTGCCGCCGGA GCTGAAGCTGTTTCTCCAGCAGCAGAAGGAGCCGCACCCGCCGGAGCAGC TCCAGCTGCCGAAGGTGCCGCCACTCCTGCCGCCGACGGAGCCACGCCCG CACCCACTCCCGCGCCAGGAGCAGAAGCACCCGCCGCCGCAGCAGCCGAG ACTCCGGCACCGCCAGCAGCCTGATCTCCACAACTTGCCCAGCTGAAGCC CACAACTATTATCGATTAAAAATAAATGACAGCAATAATAAAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Cb-RB | 1520 | lectin-46Cb-RB | 359..1398 | 1..1040 | 5140 | 99.6 | Plus |
lectin-46Cb-RA | 1472 | lectin-46Cb-RA | 434..1472 | 1..1039 | 5135 | 99.6 | Plus |
lectin-46Ca-RA | 1206 | lectin-46Ca-RA | 558..593 | 519..554 | 165 | 97.2 | Plus |
lectin-46Ca-RA | 1206 | lectin-46Ca-RA | 168..230 | 138..200 | 165 | 84.1 | Plus |
lectin-46Ca-RA | 1206 | lectin-46Ca-RA | 297..371 | 267..341 | 165 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 9816902..9817800 | 142..1040 | 4435 | 99.5 | Plus |
2R | 25260384 | 2R | 9816709..9816851 | 1..143 | 715 | 100 | Plus |
2R | 25260384 | 2R | 9819187..9819222 | 519..554 | 165 | 97.2 | Plus |
2R | 25260384 | 2R | 9818926..9819000 | 267..341 | 165 | 81.3 | Plus |
2R | 25260384 | 2R | 9818801..9818859 | 142..200 | 145 | 83 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 1048..1163 | 805..922 | 135 | 59.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 5702970..5703112 | 1..143 | 100 | -> | Plus |
chr2R | 5703165..5704060 | 144..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RA | 1..969 | 6..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..969 | 6..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..969 | 6..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RA | 1..969 | 6..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..969 | 6..974 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RA | 434..1472 | 1..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..1039 | 1..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..1039 | 1..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RA | 434..1472 | 1..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
lectin-46Cb-RB | 1..1039 | 1..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9815510..9815652 | 1..143 | 100 | -> | Plus |
2R | 9815705..9816600 | 144..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9815510..9815652 | 1..143 | 100 | -> | Plus |
2R | 9815705..9816600 | 144..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9815510..9815652 | 1..143 | 100 | -> | Plus |
2R | 9815705..9816600 | 144..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 5703015..5703157 | 1..143 | 100 | -> | Plus |
arm_2R | 5703210..5704105 | 144..1039 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 9816904..9817799 | 144..1039 | 99 | Plus | |
2R | 9816709..9816851 | 1..143 | 100 | -> | Plus |
Translation from 2 to 973
> AT03573.hyp EMKHLLTALVALLSILPRGELLGSGPPCPRRYLRRINGKCYYFSVKKMNW FGALNNCLRKGLTLADLSNQRDFDGAIGFLSGLGNTEDFWFGGNDLYHEG RFQYISNGRLVRYYSNYSNVLPLEHSECDDCLEVRIRSEINMVSADNCHE RQYFICSERYCQGTDSGKKPKHHSHEHLHHFHHDIGGSAEGEDDGDGDGD HDRQDPIASGSVEHPEPDSEDAVGALDVPDDDQPGQNGVSVTPGAEETNT VGGTGEPGATATPAAGAEAVSPAAEGAAPAGAAPAAEGAATPAADGATPA PTPAPGAEAPAAAAAETPAPPAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Cb-PB | 322 | CG1652-PB | 1..322 | 2..323 | 1744 | 100 | Plus |
lectin-46Ca-PA | 328 | CG1656-PA | 31..328 | 27..314 | 613 | 46.9 | Plus |
Tm1-PF | 501 | CG4898-PF | 329..474 | 187..323 | 161 | 37.1 | Plus |
CG12111-PB | 188 | CG12111-PB | 50..173 | 35..156 | 150 | 29.4 | Plus |
CG12111-PA | 188 | CG12111-PA | 50..173 | 35..156 | 150 | 29.4 | Plus |
Translation from 5 to 973
> AT03573.pep MKHLLTALVALLSILPRGELLGSGPPCPRRYLRRINGKCYYFSVKKMNWF GALNNCLRKGLTLADLSNQRDFDGAIGFLSGLGNTEDFWFGGNDLYHEGR FQYISNGRLVRYYSNYSNVLPLEHSECDDCLEVRIRSEINMVSADNCHER QYFICSERYCQGTDSGKKPKHHSHEHLHHFHHDIGGSAEGEDDGDGDGDH DRQDPIASGSVEHPEPDSEDAVGALDVPDDDQPGQNGVSVTPGAEETNTV GGTGEPGATATPAAGAEAVSPAAEGAAPAGAAPAAEGAATPAADGATPAP TPAPGAEAPAAAAAETPAPPAA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13387-PA | 298 | GF13387-PA | 1..290 | 1..315 | 892 | 63.2 | Plus |
Dana\GF13388-PA | 323 | GF13388-PA | 40..176 | 26..160 | 444 | 56.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24104-PA | 321 | GG24104-PA | 1..244 | 1..245 | 1094 | 91.4 | Plus |
Dere\GG24105-PA | 326 | GG24105-PA | 31..162 | 26..157 | 416 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
lectin-46Cb-PB | 322 | CG1652-PB | 1..322 | 1..322 | 1744 | 100 | Plus |
lectin-46Ca-PA | 328 | CG1656-PA | 31..328 | 26..313 | 613 | 46.9 | Plus |
Tm1-PF | 501 | CG4898-PF | 329..474 | 186..322 | 161 | 37.1 | Plus |
CG12111-PB | 188 | CG12111-PB | 50..173 | 34..155 | 150 | 29.4 | Plus |
CG12111-PA | 188 | CG12111-PA | 50..173 | 34..155 | 150 | 29.4 | Plus |
CG8343-PA | 182 | CG8343-PA | 59..179 | 46..164 | 146 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18431-PA | 363 | GI18431-PA | 8..242 | 1..220 | 716 | 63.6 | Plus |
Dmoj\GI18432-PA | 356 | GI18432-PA | 1..150 | 1..155 | 491 | 55.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17023-PA | 559 | GL17023-PA | 1..304 | 1..272 | 656 | 55.6 | Plus |
Dper\GL17024-PA | 457 | GL17024-PA | 8..183 | 4..168 | 473 | 51.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14075-PA | 577 | GA14075-PA | 1..263 | 1..268 | 732 | 64.1 | Plus |
Dpse\GA24335-PB | 590 | GA24335-PB | 37..183 | 27..168 | 488 | 56.5 | Plus |
Dpse\GA21567-PA | 381 | GA21567-PA | 247..376 | 32..155 | 149 | 32.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21152-PA | 322 | GM21152-PA | 1..322 | 1..322 | 1637 | 96.6 | Plus |
Dsec\GM21153-PA | 329 | GM21153-PA | 31..162 | 26..157 | 432 | 53 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\lectin-46Ca-PA | 329 | GD10685-PA | 31..162 | 26..157 | 433 | 53 | Plus |
Dsim\GD10684-PA | 182 | GD10684-PA | 1..158 | 141..298 | 329 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21514-PA | 406 | GJ21514-PA | 1..285 | 1..290 | 750 | 57.7 | Plus |
Dvir\GJ21515-PA | 390 | GJ21515-PA | 1..167 | 1..156 | 456 | 49.1 | Plus |
Dvir\GJ21516-PA | 181 | GJ21516-PA | 10..93 | 27..107 | 152 | 39.5 | Plus |