Clone AT03641 Report

Search the DGRC for AT03641

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:36
Well:41
Vector:pOTB7
Associated Gene/TranscriptCG43068-RA
Protein status:AT03641.pep: gold
Sequenced Size:821

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG43068-RA 2011-02-22 Manual selection by Sue Celniker

Clone Sequence Records

AT03641.complete Sequence

821 bp assembled on 2011-03-18

GenBank Submission: BT126231.1

> AT03641.complete
ATCAAACTCAATGAAATTACTTAGTATTCAGAGTCTGTGCCTTTGGCATA
CATCGCGTGGCTTTTGATTTTTATTTTATAAGTTATTACTATAGAAAACG
AGATCTGTGGACATTCACGATGCCTGGACAATACACCAACTACAAGTGCA
CTCGATTTATAATGACGGTGCTCCGGTCGTATCTGAGCATACTCTACCTA
TGGGGAATTTTGCAATTGGCTGCCATCATTCCGGTTCCCTGTGAGATCTG
GGAGACAACATTCTTGTTCGCAACAAGGTCCTTTAAAGTTGCCTACGAGT
CGTTTTTTACTAATGATCTGGCGATGTCGGTGTGTATTTGCGTCATGATC
CTCGGTGTGCTGATCTATCTGTACCACTGCTGTCGGTGCAGACTACTTGG
AGCCCGAACTTGGGGCCCAGGAGCGGCTAGGCCGCGCATGAATACACCCA
TTCTGATCTTGACGATACCCTATATCGCAGTCTTCGTCGTTTCCTGGGTA
ATCACCACCAACGCCACGTATCGCGGCATCATCTTTGTGGCTGAGAATGA
AGTGGGTGACCAAAGCGGCAGGGCGATTTTTCTATTGGTCATCGGTCTGC
TAATGAAGCTTCTAGTTTTGGCCAATTTCTATTCGGTTTGCATACGCATC
TGGGCTTACTTAAATATCTTGAATATTGGCTCGAATGATTGGCTAGTGAA
CAACTACAATTTTGGCGATCACCTCAATTTGTTCTTTTGCGTTTGAGAAG
TTGTGTATATTTTTAGCGAAAAATAATAATACTATGTTGCAAGCTAAAAA
AAAAAAAAAAAAAAAAAAAAA

AT03641.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11072356..11073150 1..795 3930 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15185158..15185956 1..799 3995 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15186357..15187155 1..799 3995 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:33:25 has no hits.

AT03641.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:34:09 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11072356..11073150 1..795 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:26 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:58:01 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:30:17 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:25 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:58:01 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:30:17 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
CG43068-RA 1..795 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:09 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15185158..15185952 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:09 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15185158..15185952 1..795 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:34:09 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15185158..15185952 1..795 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:58:01 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11072663..11073457 1..795 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:17 Download gff for AT03641.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15186357..15187151 1..795 100   Plus

AT03641.hyp Sequence

Translation from 119 to 745

> AT03641.hyp
MPGQYTNYKCTRFIMTVLRSYLSILYLWGILQLAAIIPVPCEIWETTFLF
ATRSFKVAYESFFTNDLAMSVCICVMILGVLIYLYHCCRCRLLGARTWGP
GAARPRMNTPILILTIPYIAVFVVSWVITTNATYRGIIFVAENEVGDQSG
RAIFLLVIGLLMKLLVLANFYSVCIRIWAYLNILNIGSNDWLVNNYNFGD
HLNLFFCV*

AT03641.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43068-PA 208 CG43068-PA 1..208 1..208 1109 100 Plus

AT03641.pep Sequence

Translation from 119 to 745

> AT03641.pep
MPGQYTNYKCTRFIMTVLRSYLSILYLWGILQLAAIIPVPCEIWETTFLF
ATRSFKVAYESFFTNDLAMSVCICVMILGVLIYLYHCCRCRLLGARTWGP
GAARPRMNTPILILTIPYIAVFVVSWVITTNATYRGIIFVAENEVGDQSG
RAIFLLVIGLLMKLLVLANFYSVCIRIWAYLNILNIGSNDWLVNNYNFGD
HLNLFFCV*

AT03641.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12627-PA 196 GF12627-PA 1..196 15..208 260 32.2 Plus
Dana\GF19536-PA 200 GF19536-PA 1..198 1..206 194 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG43068-PA 208 CG43068-PA 1..208 1..208 1109 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18718-PA 206 GI18718-PA 1..204 1..206 231 30.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21735-PA 208 GJ21735-PA 1..206 1..206 236 31.5 Plus