Clone AT03885 Report

Search the DGRC for AT03885

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:38
Well:85
Vector:pOTB7
Associated Gene/TranscriptCG18508-RA
Protein status:AT03885.pep: gold
Sequenced Size:595

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18508 2011-03-15 Manual selection by Sue Celniker

Clone Sequence Records

AT03885.complete Sequence

595 bp assembled on 2011-04-26

GenBank Submission: BT126356.1

> AT03885.complete
AGAAATACATTTTTTCCGGAGCCAGTAAGCTAACATTAAATAGCCCGAAC
AATGGTTTGCGTGCCCTGTATTATCATTCCACTGCTTCTGTACATTTGGC
ACAAATTTGTGCAGCCGATCCTGTTGCGCTACTGGAATCCCTGGGAGAAG
AAGGACGACGATGGCAATGTGATCAAAAAGGGACCCGACTTCCCATTCGA
GTGCAAGGGCGGCGTTTGCCCCTTCGTTCCGGGCGGCAAGAAGACGGAGA
ACGTCAGTGATGACGATGCCGAGGAATCTGAAAATCCGCCATTGAATGCA
ACAGCAATGGCAGCGGAAACGGAAGTGGACGAGTCCAAGAAGGAGATCTA
GTCGAAATGTTCCAAATATTGTAATTTAACACATAGTACATTTTTTTTTT
TGTTATGTTTTGACATAAGAGCGGAAAACACAACGCACACAACACAAGGA
CACAAATCCAACGTGGTGGGCGGCGATCGTTTGGTAAAGGAGGGGGAGGG
GGCGTGGCCCTTGAAGAGCGGCAAGAAGGTCTAATGTATAATTAACTTGC
AATTAAATGTACACTTTGACACGCGAAAAAAAAAAAAAAAAAAAA

AT03885.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3066131..3066663 575..42 2620 99.8 Minus
chrX 22417052 chrX 3066719..3066761 43..1 215 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3172448..3172989 581..42 2615 99.3 Minus
X 23542271 X 3173045..3173087 43..1 200 97.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3180546..3181087 581..42 2625 99.2 Minus
X 23527363 X 3181143..3181185 43..1 200 97.6 Minus
Blast to na_te.dros performed on 2019-03-15 10:35:03 has no hits.

AT03885.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:35:51 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3066131..3066661 44..575 99 <- Minus
chrX 3066719..3066761 1..43 100   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-04-27 15:22:49 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 1..300 52..351 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:20:37 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 1..300 52..351 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:07:14 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 1..300 52..351 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-04-27 15:22:49 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 53..629 1..575 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:20:37 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 54..630 1..575 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:07:14 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
CG18508-RA 54..630 1..575 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:51 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
X 3172454..3172987 44..575 99 <- Minus
X 3173045..3173087 1..43 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:51 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
X 3172454..3172987 44..575 99 <- Minus
X 3173045..3173087 1..43 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:35:51 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
X 3172454..3172987 44..575 99 <- Minus
X 3173045..3173087 1..43 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:20:37 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3066487..3067020 44..575 99 <- Minus
arm_X 3067078..3067120 1..43 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:57:35 Download gff for AT03885.complete
Subject Subject Range Query Range Percent Splice Strand
X 3180552..3181085 44..575 99 <- Minus
X 3181143..3181185 1..43 97   Minus

AT03885.pep Sequence

Translation from 51 to 350

> AT03885.pep
MVCVPCIIIPLLLYIWHKFVQPILLRYWNPWEKKDDDGNVIKKGPDFPFE
CKGGVCPFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKEI*

AT03885.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19617-PA 106 GF19617-PA 1..106 1..99 350 63.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18593-PA 104 GG18593-PA 1..104 1..99 372 71.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12606-PA 105 GH12606-PA 1..104 1..98 341 63.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG18508-PB 99 CG18508-PB 1..99 1..99 550 100 Plus
CG18508-PA 99 CG18508-PA 1..99 1..99 550 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10951-PA 119 GI10951-PA 1..72 1..72 334 81.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19782-PA 127 GL19782-PA 1..70 1..70 327 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14967-PA 127 GA14967-PA 1..70 1..70 331 87.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18843-PA 98 GM18843-PA 1..98 1..99 366 81 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16342-PA 97 GD16342-PA 1..97 1..99 429 84.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15269-PA 115 GJ15269-PA 1..84 1..84 341 75 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15941-PA 104 GK15941-PA 1..104 1..99 330 60.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:48:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16906-PA 102 GE16906-PA 1..102 1..92 344 66.7 Plus

AT03885.hyp Sequence

Translation from 51 to 350

> AT03885.hyp
MVCVPCIIIPLLLYIWHKFVQPILLRYWNPWEKKDDDGNVIKKGPDFPFE
CKGGVCPFVPGGKKTENVSDDDAEESENPPLNATAMAAETEVDESKKEI*

AT03885.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18508-PB 99 CG18508-PB 1..99 1..99 550 100 Plus
CG18508-PA 99 CG18508-PA 1..99 1..99 550 100 Plus