Clone AT04058 Report

Search the DGRC for AT04058

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:40
Well:58
Vector:pOTB7
Associated Gene/TranscriptCG15219-RA
Protein status:AT04058.pep: gold
Sequenced Size:508

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15219-RA 2009-01-21 est gleaning

Clone Sequence Records

AT04058.complete Sequence

508 bp assembled on 2009-02-12

GenBank Submission: BT058098.1

> AT04058.complete
CATCTCTAAAAAACAAAAAAAAAAAATTGTAAAAATTTTATAAGAAAGTC
AAGTAAAATCTTTTTTCAAAATTTTCAGTCATGGAATACGGAAATGGTAT
GCAATACGATGGTTATAGCCAAGGTGGCGAGGGCTTTGAAATGCTGTACA
ACCAAACGAGCAGTGGCCATGGATATAGCCAGCAGCAGAGTAATTGCGGA
CAAGGTTCTTCAAATTTTAATGGTGCATCTGCATCGCTTGGAGGTCCTGG
CTATCGCAGTCCTTTGCGATACACAAAAATGCTTCGTGAGATGAACTCTC
GCAACGGGCTTTACTCTCCAATGGAACAGCAGCGGAGCAGTGGGCAAGGC
GACTACTATAATACATTGCCCGGCCTTGGCGGCCCAGAAGGTCAAGCTTA
TCAGTCGCGGGGCAATGGAAATCCATACTACTAAAGTAAACCCATGCACT
TCGTAGAAATTGTTGATATAATTTAATAAAATAAATTTTGAAAAAAAAAA
AAAAAAAA

AT04058.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219-RA 574 CG15219-RA 72..566 1..493 2390 99.1 Plus
CG15219.b 481 CG15219.b 6..321 1..314 1495 98.7 Plus
CG15219.a 478 CG15219.a 6..321 1..314 1495 98.7 Plus
CG15219.b 481 CG15219.b 321..481 330..490 805 100 Plus
CG15219.a 478 CG15219.a 321..478 333..490 790 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22103643..22103826 313..130 890 98.9 Minus
chr2L 23010047 chr2L 22103418..22103594 490..314 870 99.4 Minus
chr2L 23010047 chr2L 22103877..22104007 132..1 610 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22104888..22105067 493..314 900 100 Minus
2L 23513712 2L 22105116..22105299 313..130 890 98.9 Minus
2L 23513712 2L 22105350..22105483 132..1 605 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22104888..22105067 493..314 900 100 Minus
2L 23513712 2L 22105116..22105299 313..130 890 98.9 Minus
2L 23513712 2L 22105350..22105483 132..1 615 98.5 Minus
Blast to na_te.dros performed on 2019-03-16 19:29:21 has no hits.

AT04058.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:30:01 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22103447..22103594 314..461 99 <- Minus
chr2L 22103643..22103824 132..313 98 <- Minus
chr2L 22103878..22103960 49..131 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:05:34 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..354 81..434 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:34:34 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..354 81..434 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:42 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..354 81..434 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:47 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 1..354 81..434 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-12 16:46:49 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 24..515 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:34:34 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 24..515 1..490 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:42 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 30..521 1..490 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:47 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
CG15219-RA 30..521 1..490 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:30:01 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105067 314..490 100 <- Minus
2L 22105116..22105297 132..313 98 <- Minus
2L 22105351..22105483 1..131 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:30:01 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105067 314..490 100 <- Minus
2L 22105116..22105297 132..313 98 <- Minus
2L 22105351..22105483 1..131 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:30:01 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105067 314..490 100 <- Minus
2L 22105116..22105297 132..313 98 <- Minus
2L 22105351..22105483 1..131 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:42 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22105116..22105297 132..313 98 <- Minus
arm_2L 22105351..22105483 1..131 98   Minus
arm_2L 22104891..22105067 314..490 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:07:56 Download gff for AT04058.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22104891..22105067 314..490 100 <- Minus
2L 22105116..22105297 132..313 98 <- Minus
2L 22105351..22105483 1..131 98   Minus

AT04058.pep Sequence

Translation from 80 to 433

> AT04058.pep
MEYGNGMQYDGYSQGGEGFEMLYNQTSSGHGYSQQQSNCGQGSSNFNGAS
ASLGGPGYRSPLRYTKMLREMNSRNGLYSPMEQQRSSGQGDYYNTLPGLG
GPEGQAYQSRGNGNPYY*

AT04058.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23721-PA 122 GF23721-PA 1..114 1..113 281 64.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:02:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21360-PA 120 GG21360-PA 1..79 1..79 358 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11280-PA 128 GH11280-PA 33..128 29..117 240 59.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219-PA 117 CG15219-PA 1..117 1..117 642 100 Plus
CG15219-PC 119 CG15219-PC 1..79 1..79 428 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24421-PA 126 GI24421-PA 34..126 23..117 260 62.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26111-PA 137 GL26111-PA 41..137 28..117 250 68 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13579-PA 137 GA13579-PA 41..137 28..117 250 68 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16117-PA 119 GM16117-PA 1..78 1..78 382 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:02:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21620-PA 119 GD21620-PA 1..79 1..79 382 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16205-PA 125 GJ16205-PA 50..125 43..117 251 71.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18700-PA 132 GK18700-PA 1..132 1..117 241 57.1 Plus
Dwil\GK18720-PA 132 GK18720-PA 15..132 3..116 174 38.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12940-PA 113 GE12940-PA 1..78 1..78 350 91 Plus

AT04058.hyp Sequence

Translation from 80 to 433

> AT04058.hyp
MEYGNGMQYDGYSQGGEGFEMLYNQTSSGHGYSQQQSNCGQGSSNFNGAS
ASLGGPGYRSPLRYTKMLREMNSRNGLYSPMEQQRSSGQGDYYNTLPGLG
GPEGQAYQSRGNGNPYY*

AT04058.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15219-PA 117 CG15219-PA 1..117 1..117 642 100 Plus
CG15219-PC 119 CG15219-PC 1..79 1..79 428 100 Plus