Clone AT04152 Report

Search the DGRC for AT04152

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:41
Well:52
Vector:pOTB7
Associated Gene/TranscriptCG12617-RA
Protein status:AT04152.pep: gold
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12617 2003-01-01 Sim4 clustering to Release 3
CG12617 2004-01-31 Blastp of sequenced clone
CG12617 2008-04-29 Release 5.5 accounting

Clone Sequence Records

AT04152.complete Sequence

471 bp (471 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011565

> AT04152.complete
AACATCTTTGGGAGCAACATGAGTATTTCTTTAATACGCAAACATCTGAA
CGAGATGGGGACCCTTAAGCTCCGATCGTCCATGGGTCGGAACTATATTC
CCATGGCCGGTCCTCCTCGATTTCCGATGAGTTCAGCGCAGCGTTTGATC
TTTGGTTGCGGTTCCTTGGTTGTCATGATGATCATTCCCTTCTACTGCCT
CTTCAGCCTGCCCCGATGGTCGAGGATGCATTTGGGACTTCCGCCGGAGG
AGGACGAGCAGGCGGAGGAGCCTCCACCACAAGAGGAAAAGGACAAGGAG
AAGAAATAGATCCCTGATCTTACGACACGCTTTCCTTTAAACGGTGACTT
CTGAATAACACTTTCCTGGGGTTTCCATAAAAAGAACTTGCAACTGCGTG
GCGCTATTTCTATCAACAACGCAGCATATTAAAATTGCGCCATATCGATC
GTTAAAAAAAAAAAAAAAAAA

AT04152.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-RA 576 CG12617-RA 79..535 1..457 2285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20293302..20293745 10..453 2220 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20294877..20295324 10..457 2240 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20294877..20295324 10..457 2240 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:48:53 has no hits.

AT04152.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:06 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20293292..20293745 1..453 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:51:39 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 1..291 19..309 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:47 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 1..291 19..309 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:57 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 1..291 19..309 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:53 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 1..291 19..309 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:42:53 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 1..291 19..309 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:56 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 72..524 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:47 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 72..524 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:57 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 78..530 1..453 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:53 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 72..524 1..453 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:42:53 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
CG12617-RA 86..538 1..453 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:06 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20294867..20295320 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:06 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20294867..20295320 1..453 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:06 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20294867..20295320 1..453 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:57 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20294867..20295320 1..453 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:57 Download gff for AT04152.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20294867..20295320 1..453 99   Plus

AT04152.hyp Sequence

Translation from 1 to 308

> AT04152.hyp
TISGSNMSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLI
FGCGSLVVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKE
KK*

AT04152.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-PC 96 CG12617-PC 1..96 7..102 510 100 Plus
CG12617-PB 96 CG12617-PB 1..96 7..102 510 100 Plus
CG12617-PA 96 CG12617-PA 1..96 7..102 510 100 Plus

AT04152.pep Sequence

Translation from 18 to 308

> AT04152.pep
MSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLIFGCGSL
VVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKEKK*

AT04152.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14533-PA 125 GF14533-PA 32..90 17..75 162 57.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21226-PA 108 GG21226-PA 1..74 1..74 330 86.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13127-PA 108 GH13127-PA 45..108 24..89 187 56.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG12617-PC 96 CG12617-PC 1..96 1..96 510 100 Plus
CG12617-PB 96 CG12617-PB 1..96 1..96 510 100 Plus
CG12617-PA 96 CG12617-PA 1..96 1..96 510 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22748-PA 105 GI22748-PA 49..105 24..80 136 42.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26603-PA 107 GL26603-PA 1..76 1..74 208 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:48:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11720-PA 107 GA11720-PA 1..76 1..74 208 53.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23343-PA 89 GM23343-PA 1..89 1..89 450 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24251-PA 128 GD24251-PA 40..128 1..89 451 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23307-PA 109 GJ23307-PA 47..94 24..71 169 58.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18262-PA 129 GK18262-PA 50..103 24..77 187 57.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13303-PA 106 GE13303-PA 1..74 1..74 353 91.9 Plus