BDGP Sequence Production Resources |
Search the DGRC for AT04152
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 41 |
Well: | 52 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG12617-RA |
Protein status: | AT04152.pep: gold |
Sequenced Size: | 471 |
Gene | Date | Evidence |
---|---|---|
CG12617 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12617 | 2004-01-31 | Blastp of sequenced clone |
CG12617 | 2008-04-29 | Release 5.5 accounting |
471 bp (471 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011565
> AT04152.complete AACATCTTTGGGAGCAACATGAGTATTTCTTTAATACGCAAACATCTGAA CGAGATGGGGACCCTTAAGCTCCGATCGTCCATGGGTCGGAACTATATTC CCATGGCCGGTCCTCCTCGATTTCCGATGAGTTCAGCGCAGCGTTTGATC TTTGGTTGCGGTTCCTTGGTTGTCATGATGATCATTCCCTTCTACTGCCT CTTCAGCCTGCCCCGATGGTCGAGGATGCATTTGGGACTTCCGCCGGAGG AGGACGAGCAGGCGGAGGAGCCTCCACCACAAGAGGAAAAGGACAAGGAG AAGAAATAGATCCCTGATCTTACGACACGCTTTCCTTTAAACGGTGACTT CTGAATAACACTTTCCTGGGGTTTCCATAAAAAGAACTTGCAACTGCGTG GCGCTATTTCTATCAACAACGCAGCATATTAAAATTGCGCCATATCGATC GTTAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12617-RA | 576 | CG12617-RA | 79..535 | 1..457 | 2285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 20293302..20293745 | 10..453 | 2220 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 20294877..20295324 | 10..457 | 2240 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 20294877..20295324 | 10..457 | 2240 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 20293292..20293745 | 1..453 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 1..291 | 19..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 1..291 | 19..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 1..291 | 19..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 1..291 | 19..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 1..291 | 19..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 72..524 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 72..524 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 78..530 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 72..524 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12617-RA | 86..538 | 1..453 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20294867..20295320 | 1..453 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20294867..20295320 | 1..453 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20294867..20295320 | 1..453 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 20294867..20295320 | 1..453 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 20294867..20295320 | 1..453 | 99 | Plus |
Translation from 1 to 308
> AT04152.hyp TISGSNMSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLI FGCGSLVVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKE KK*
Translation from 18 to 308
> AT04152.pep MSISLIRKHLNEMGTLKLRSSMGRNYIPMAGPPRFPMSSAQRLIFGCGSL VVMMIIPFYCLFSLPRWSRMHLGLPPEEDEQAEEPPPQEEKDKEKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14533-PA | 125 | GF14533-PA | 32..90 | 17..75 | 162 | 57.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21226-PA | 108 | GG21226-PA | 1..74 | 1..74 | 330 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13127-PA | 108 | GH13127-PA | 45..108 | 24..89 | 187 | 56.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12617-PC | 96 | CG12617-PC | 1..96 | 1..96 | 510 | 100 | Plus |
CG12617-PB | 96 | CG12617-PB | 1..96 | 1..96 | 510 | 100 | Plus |
CG12617-PA | 96 | CG12617-PA | 1..96 | 1..96 | 510 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22748-PA | 105 | GI22748-PA | 49..105 | 24..80 | 136 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26603-PA | 107 | GL26603-PA | 1..76 | 1..74 | 208 | 53.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11720-PA | 107 | GA11720-PA | 1..76 | 1..74 | 208 | 53.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23343-PA | 89 | GM23343-PA | 1..89 | 1..89 | 450 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24251-PA | 128 | GD24251-PA | 40..128 | 1..89 | 451 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23307-PA | 109 | GJ23307-PA | 47..94 | 24..71 | 169 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18262-PA | 129 | GK18262-PA | 50..103 | 24..77 | 187 | 57.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13303-PA | 106 | GE13303-PA | 1..74 | 1..74 | 353 | 91.9 | Plus |