Clone AT04445 Report

Search the DGRC for AT04445

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:44
Well:45
Vector:pOTB7
Associated Gene/TranscriptMESK2-RC
Protein status:AT04445.pep: gold
Preliminary Size:5233
Sequenced Size:1643

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15669 2002-09-24 Blastp of sequenced clone
MESK2 2008-04-29 Release 5.5 accounting
MESK2 2008-08-15 Release 5.9 accounting
MESK2 2008-12-18 5.12 accounting

Clone Sequence Records

AT04445.complete Sequence

1643 bp (1643 high quality bases) assembled on 2002-09-24

GenBank Submission: BT001267

> AT04445.complete
CAGAAATCAAGCGAAAGACCCAAAAAAGCATGCCACAGTCAGAGGGCGGC
TATGTATCGCTGCCGGCCGTCAATGGCAATGGCGGCGCCATCTATCAGTC
GACCACAGAGCCCACGGCCCCGCCCTCCGTTTTTGCGAGCGTGAAGCGGG
CCATTGGCCAGGCCATCAAGTCCTCGCCCACCGACAGCGAGGAGCTGCTC
CGGTCGGACCGCCTGCCGGTCATCGTCGGCGGCTCCAGAGACCGCGACAA
ATCCGGTAAGACACTGACCACCAAGATGCCGTCAGCTCCAACACACACTG
CCGAGGAGGCACATCTGCTGGGCACCATGCCCGTTGATCCCATGGATGAC
ATCGAACTGCGCTCCGTGCAGCTGCAATTCCCCAATGCCCGCGGCTCCAT
CCTGGAGGCCTGCGAACAGCGACGCGTGCCCACAGACAAGGGCGATGTCC
ACGTGGCCATACAGGGCGATACGGCCAAGCCGGCCATTATCACCTACCAC
GATTTGGGCCTCAACTACGCCACCAGCTTTGCTGGCTTCTTCAATTTTCC
AGTGATGCGAGGTCTGCTGGAGAACTTCTGTGTTTACCATGTGACTGCTC
CTGGCCAGGAGGAGGGTGCACCCACTTTGCCAGAGGATTACGTCTATCCG
ACCATGGATGATCTGGCCGCCCAGCTGCTTTTCGTGCTATCCCACTTTGG
CCTAAAGTCGGTGATTGGTTTCGGCGTTGGTGCCGGGGCGAATATTCTGG
CACGTTTCGCTCACGCCCATCCGGACAAGGTGGGCGCCCTGTGCCTGATC
AATTGCGTGTCCACGCAGTCGGGCTGGATCGAGTGGGGCTACCAGAGCTT
CAATGCCCGCTTCTTGCGCACCAAGGGCATGACACAGGGCGTGATCGATT
ATCTGATGTGGCACCACTTCGGACGCAATCCGGAGGAGCGCAATCACGAC
CTGGTGCAGATGTACAAGCAGCACTTCGAGCGTGGCGTTAATCCGACCAA
TCTTGCCATGCTGATCAACGCGTACATCCATCGCAACGACCTGCATCTGG
CGCGCACTCCGCCAGGAACTCCGGGCAGCGAAACGGCGGCCACCACGCTG
AAGATGCCGGTGATCAATATTACGGGTTCGCTCTCGCCGCACGTCGACGA
CACGGTGACCTTCAATGGCCGTCTAGATCCTACAAACTCATCGTGGATGA
AGATTTCCGATTGCGCTTTGGTGCTGGAGGAGCAGCCGGCTAAGCTGGCC
GAGGCCTTCCGGCTCTTCTTGCAGGGCGAGGGCTACGTCAAGTACTTCCG
ACCCGGCGACTGGGATGGCACTCAGTTGAGCAGCTTCATCTAGAAGTCCA
TTCCGTTTGGAGCAAGATATCCCCTCCATAGATTCAGTTCAGTTCAGTTC
AGCTCAGTTTTCCCACAGGAGATGCTCCTCCTAGCTTAGCCCCCGATTTT
CTCCGTGGAGACACACGCACACACAAAGTACACAAACGTCCCTGACCCAA
CCTGATTTTAGTCTAAACGAAAATCTTTGAGAATCAAAAGCTTTTTGAGA
TGCATTGAAACGAAACCAAAAATCTATTGTGCAAAATTTTATATTTACAA
ATTGGTTAGATATACAAAACAAAACAAAAAAAAAAAAAAAAAA

AT04445.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2.r 1941 MESK2.r 327..1941 1..1615 7970 99.5 Plus
MESK2.n 2189 MESK2.n 575..2189 1..1615 7970 99.5 Plus
MESK2-RC 2240 MESK2-RC 626..2240 1..1615 7970 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17397894..17398458 638..1202 2735 98.9 Plus
chr2R 21145070 chr2R 17398882..17399220 1287..1625 1695 100 Plus
chr2R 21145070 chr2R 17393961..17394200 1..238 1135 99.2 Plus
chr2R 21145070 chr2R 17397348..17397542 322..516 975 100 Plus
chr2R 21145070 chr2R 17397605..17397725 517..637 590 99.2 Plus
chr2R 21145070 chr2R 17398581..17398667 1201..1287 435 100 Plus
chr2R 21145070 chr2R 17396597..17396683 236..322 420 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21511404..21511968 638..1202 2735 98.9 Plus
2R 25286936 2R 21512392..21512737 1287..1632 1715 99.7 Plus
2R 25286936 2R 21507485..21507722 1..238 1190 100 Plus
2R 25286936 2R 21510866..21511060 322..516 975 100 Plus
2R 25286936 2R 21511123..21511243 517..637 590 99.2 Plus
2R 25286936 2R 21510115..21510201 236..322 435 100 Plus
2R 25286936 2R 21512091..21512177 1201..1287 435 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21512603..21513167 638..1202 2735 98.9 Plus
2R 25260384 2R 21513591..21513936 1287..1632 1715 99.7 Plus
2R 25260384 2R 21508684..21508921 1..238 1190 100 Plus
2R 25260384 2R 21512065..21512259 322..516 975 100 Plus
2R 25260384 2R 21512322..21512442 517..637 590 99.1 Plus
2R 25260384 2R 21513290..21513376 1201..1287 435 100 Plus
2R 25260384 2R 21511314..21511400 236..322 435 100 Plus
Blast to na_te.dros performed 2019-03-16 18:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy10 6006 gypsy10 GYPSY10 6006bp 800..832 1586..1619 113 85.3 Plus

AT04445.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:26 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17397349..17397542 323..516 100 -> Plus
chr2R 17397605..17397725 517..637 99 -> Plus
chr2R 17393961..17394200 1..238 99 -> Plus
chr2R 17396600..17396683 239..322 98 -> Plus
chr2R 17397894..17398458 638..1202 98 -> Plus
chr2R 17398583..17398667 1203..1287 100 -> Plus
chr2R 17398883..17399220 1288..1625 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:51:51 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 1..1314 30..1343 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:14:13 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 1..1314 30..1343 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:40 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 1..1314 30..1343 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:05:16 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 1..1314 30..1343 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:33 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 1..1314 30..1343 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:37:15 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 585..2199 1..1615 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:14:13 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 585..2199 1..1615 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:40 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 574..2193 1..1620 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:05:16 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 585..2199 1..1615 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:33 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
MESK2-RC 574..2193 1..1620 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:26 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21510867..21511060 323..516 100 -> Plus
2R 21511123..21511243 517..637 99 -> Plus
2R 21510118..21510201 239..322 100 -> Plus
2R 21507485..21507722 1..238 100 -> Plus
2R 21511404..21511968 638..1202 98 -> Plus
2R 21512093..21512177 1203..1287 100 -> Plus
2R 21512393..21512729 1288..1625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:26 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21510867..21511060 323..516 100 -> Plus
2R 21511123..21511243 517..637 99 -> Plus
2R 21510118..21510201 239..322 100 -> Plus
2R 21507485..21507722 1..238 100 -> Plus
2R 21511404..21511968 638..1202 98 -> Plus
2R 21512093..21512177 1203..1287 100 -> Plus
2R 21512393..21512729 1288..1625 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:26 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21510867..21511060 323..516 100 -> Plus
2R 21511123..21511243 517..637 99 -> Plus
2R 21510118..21510201 239..322 100 -> Plus
2R 21507485..21507722 1..238 100 -> Plus
2R 21511404..21511968 638..1202 98 -> Plus
2R 21512093..21512177 1203..1287 100 -> Plus
2R 21512393..21512729 1288..1625 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:40 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17394990..17395227 1..238 100 -> Plus
arm_2R 17397623..17397706 239..322 100 -> Plus
arm_2R 17398372..17398565 323..516 100 -> Plus
arm_2R 17398628..17398748 517..637 99 -> Plus
arm_2R 17398909..17399473 638..1202 98 -> Plus
arm_2R 17399598..17399682 1203..1287 100 -> Plus
arm_2R 17399898..17400234 1288..1625 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:37:03 Download gff for AT04445.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21508684..21508921 1..238 100 -> Plus
2R 21511317..21511400 239..322 100 -> Plus
2R 21512066..21512259 323..516 100 -> Plus
2R 21512322..21512442 517..637 99 -> Plus
2R 21512603..21513167 638..1202 98 -> Plus
2R 21513292..21513376 1203..1287 100 -> Plus
2R 21513592..21513928 1288..1625 99   Plus

AT04445.hyp Sequence

Translation from 2 to 1342

> AT04445.hyp
EIKRKTQKSMPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVKRA
IGQAIKSSPTDSEELLRSDRLPVIVGGSRDRDKSGKTLTTKMPSAPTHTA
EEAHLLGTMPVDPMDDIELRSVQLQFPNARGSILEACEQRRVPTDKGDVH
VAIQGDTAKPAIITYHDLGLNYATSFAGFFNFPVMRGLLENFCVYHVTAP
GQEEGAPTLPEDYVYPTMDDLAAQLLFVLSHFGLKSVIGFGVGAGANILA
RFAHAHPDKVGALCLINCVSTQSGWIEWGYQSFNARFLRTKGMTQGVIDY
LMWHHFGRNPEERNHDLVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLA
RTPPGTPGSETAATTLKMPVINITGSLSPHVDDTVTFNGRLDPTNSSWMK
ISDCALVLEEQPAKLAEAFRLFLQGEGYVKYFRPGDWDGTQLSSFI*

AT04445.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2-PC 437 CG15669-PC 1..437 10..446 2315 100 Plus
MESK2-PB 425 CG15669-PB 1..420 10..429 2218 100 Plus
MESK2-PE 447 CG15669-PE 1..419 10..428 2214 100 Plus
MESK2-PF 447 CG15669-PF 1..419 10..428 2214 100 Plus
MESK2-PA 447 CG15669-PA 1..419 10..428 2214 100 Plus

AT04445.pep Sequence

Translation from 29 to 1342

> AT04445.pep
MPQSEGGYVSLPAVNGNGGAIYQSTTEPTAPPSVFASVKRAIGQAIKSSP
TDSEELLRSDRLPVIVGGSRDRDKSGKTLTTKMPSAPTHTAEEAHLLGTM
PVDPMDDIELRSVQLQFPNARGSILEACEQRRVPTDKGDVHVAIQGDTAK
PAIITYHDLGLNYATSFAGFFNFPVMRGLLENFCVYHVTAPGQEEGAPTL
PEDYVYPTMDDLAAQLLFVLSHFGLKSVIGFGVGAGANILARFAHAHPDK
VGALCLINCVSTQSGWIEWGYQSFNARFLRTKGMTQGVIDYLMWHHFGRN
PEERNHDLVQMYKQHFERGVNPTNLAMLINAYIHRNDLHLARTPPGTPGS
ETAATTLKMPVINITGSLSPHVDDTVTFNGRLDPTNSSWMKISDCALVLE
EQPAKLAEAFRLFLQGEGYVKYFRPGDWDGTQLSSFI*

AT04445.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12819-PA 448 GF12819-PA 1..420 1..419 2204 96.9 Plus
Dana\GF18647-PA 370 GF18647-PA 23..311 126..420 399 32.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22116-PA 570 GG22116-PA 1..422 1..420 2245 98.8 Plus
Dere\GG10854-PA 367 GG10854-PA 20..308 126..420 402 31.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21835-PA 450 GH21835-PA 1..422 1..419 2156 94.3 Plus
Dgri\GH19438-PA 362 GH19438-PA 19..308 125..420 403 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:32
Subject Length Description Subject Range Query Range Score Percent Strand
MESK2-PC 437 CG15669-PC 1..437 1..437 2315 100 Plus
MESK2-PB 425 CG15669-PB 1..420 1..420 2218 100 Plus
MESK2-PE 447 CG15669-PE 1..419 1..419 2214 100 Plus
MESK2-PF 447 CG15669-PF 1..419 1..419 2214 100 Plus
MESK2-PA 447 CG15669-PA 1..419 1..419 2214 100 Plus
MESK2-PK 409 CG15669-PK 1..409 1..437 2125 93.4 Plus
MESK2-PI 485 CG15669-PI 1..337 83..419 1802 100 Plus
MESK2-PD 365 CG15669-PD 1..337 83..419 1802 100 Plus
MESK2-PJ 468 CG15669-PJ 1..320 100..419 1712 100 Plus
CG2082-PA 365 CG2082-PA 21..304 126..418 383 32.7 Plus
CG2082-PJ 361 CG2082-PJ 24..300 133..418 381 33.1 Plus
CG2082-PC 361 CG2082-PC 24..300 133..418 381 33.1 Plus
CG2082-PG 368 CG2082-PG 21..307 126..418 378 32.1 Plus
CG2082-PL 363 CG2082-PL 24..302 133..418 377 32.6 Plus
CG2082-PH 363 CG2082-PH 24..302 133..418 377 32.6 Plus
CG2082-PK 364 CG2082-PK 24..303 133..418 376 32.6 Plus
CG2082-PB 364 CG2082-PB 24..303 133..418 376 32.6 Plus
CG2082-PO 335 CG2082-PO 1..230 176..418 315 31.9 Plus
CG2082-PD 201 CG2082-PD 21..197 126..300 285 37.4 Plus
CG2082-PN 197 CG2082-PN 24..193 133..300 283 38.3 Plus
CG2082-PM 211 CG2082-PM 29..200 129..298 281 37.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19078-PA 549 GI19078-PA 1..423 1..420 2124 92.7 Plus
Dmoj\GI22641-PA 361 GI22641-PA 26..307 133..420 404 32 Plus
Dmoj\GI17264-PA 73 GI17264-PA 1..70 1..68 256 77.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16980-PA 563 GL16980-PA 19..433 6..420 2146 94.7 Plus
Dper\GL23012-PA 368 GL23012-PA 21..309 126..420 394 31.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25012-PB 447 GA25012-PB 1..419 1..419 2177 94.7 Plus
Dpse\GA25012-PH 425 GA25012-PH 1..420 1..420 2171 94.8 Plus
Dpse\GA25012-PC 422 GA25012-PC 1..421 1..421 2168 94.5 Plus
Dpse\GA25012-PF 394 GA25012-PF 1..393 1..421 1985 88.1 Plus
Dpse\GA25012-PD 470 GA25012-PD 1..338 83..420 1807 96.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15838-PA 447 GM15838-PA 1..419 1..419 2266 100 Plus
Dsec\GM10591-PA 383 GM10591-PA 36..324 126..420 400 31.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11599-PA 536 GD11599-PA 1..420 1..420 2265 99.8 Plus
Dsim\GD19583-PA 368 GD19583-PA 21..309 126..420 401 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20053-PA 553 GJ20053-PA 1..425 1..420 2125 92.9 Plus
Dvir\GJ23888-PA 360 GJ23888-PA 7..306 118..420 387 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20902-PA 562 GK20902-PA 1..427 1..419 2084 91.1 Plus
Dwil\GK13862-PA 388 GK13862-PA 40..328 126..420 395 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:48:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12198-PA 429 GE12198-PA 1..424 1..420 2241 98.6 Plus
Dyak\GE24139-PA 368 GE24139-PA 21..309 126..420 399 31.9 Plus