BDGP Sequence Production Resources |
Search the DGRC for AT04446
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 44 |
Well: | 46 |
Vector: | pOTB7 |
Associated Gene/Transcript | agt-RA |
Protein status: | AT04446.pep: gold |
Preliminary Size: | 695 |
Sequenced Size: | 698 |
Gene | Date | Evidence |
---|---|---|
CG1303 | 2002-01-01 | Sim4 clustering to Release 2 |
CG1303 | 2002-01-16 | Blastp of sequenced clone |
CG1303 | 2003-01-01 | Sim4 clustering to Release 3 |
agt | 2008-04-29 | Release 5.5 accounting |
agt | 2008-08-15 | Release 5.9 accounting |
agt | 2008-12-18 | 5.12 accounting |
698 bp (698 high quality bases) assembled on 2002-01-16
GenBank Submission: AY089255
> AT04446.complete TCACGAAATTCGTTTAAACTTGACCACGAAATTAAGCGATAAATGACGAT GTGGATTGGCCAAAACACCCAGATTCGTTTGGTGCCACTAAAGGATCCGC CAAAGACCATCCGATACAGTTTCCTGGCGACCAAGTTCGGGCAGATGATG ATGGGAGTGATAAACCCAATATCCGGCGATTCGAAAGACCAAGTCGCAAT TGGTGTGCTTCACTTCGTGATTAAGGACAATGTGAGTACCTACAATGAAG TCCAGGAGCGGTGGCCAAAATCCGAACTCTGGAAGGACGATGATGCGGTC AAGTTGGTGGCGGATAAACTGTTCGAAAGCGACAAGGAAAACTCGCAGGC GATTCCCATTGCCATCTATGGAACCGACTTCCAGCTGTCCGTATGGCGAG CTCTGGTGCATATGAAACGAGGGGAGACCTGCACTTACTCCCAACTGGCC GAGCGGATGGGTCGTCCAACGGCGGTCAGAGCAGTGGCCAGTGCTGTGGC CAAAAATGAGCTTGCTATCCTCATTCCGTGCCACCGAGTTGTGTCCCAAA ACGGAGCTTCGAAGTACCACTGGGGCGCAGCCCTCAAGCAACTGCTTCTG GCCGATGAAAAGTCAAAGAACTATTAAAAATCGTTACTCGTATCTTTATT GAAACTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 2485210..2485866 | 657..1 | 3285 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 6659406..6660064 | 659..1 | 3295 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 6400237..6400895 | 659..1 | 3295 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 2485210..2485866 | 1..657 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 1..585 | 43..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 1..585 | 43..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 1..585 | 43..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 1..585 | 43..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 1..585 | 43..627 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 37..693 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 37..693 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 37..693 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 37..693 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
agt-RA | 37..693 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6659408..6660064 | 1..657 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6659408..6660064 | 1..657 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6659408..6660064 | 1..657 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 2485130..2485786 | 1..657 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 6400239..6400895 | 1..657 | 100 | Minus |
Translation from 42 to 626
> AT04446.hyp MTMWIGQNTQIRLVPLKDPPKTIRYSFLATKFGQMMMGVINPISGDSKDQ VAIGVLHFVIKDNVSTYNEVQERWPKSELWKDDDAVKLVADKLFESDKEN SQAIPIAIYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVAS AVAKNELAILIPCHRVVSQNGASKYHWGAALKQLLLADEKSKNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
agt-PA | 194 | CG1303-PA | 1..194 | 1..194 | 1007 | 100 | Plus |
Translation from 42 to 626
> AT04446.pep MTMWIGQNTQIRLVPLKDPPKTIRYSFLATKFGQMMMGVINPISGDSKDQ VAIGVLHFVIKDNVSTYNEVQERWPKSELWKDDDAVKLVADKLFESDKEN SQAIPIAIYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVAS AVAKNELAILIPCHRVVSQNGASKYHWGAALKQLLLADEKSKNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17804-PA | 186 | GF17804-PA | 1..184 | 3..191 | 578 | 61.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10335-PA | 167 | GG10335-PA | 1..147 | 3..149 | 564 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19491-PA | 188 | GH19491-PA | 1..182 | 3..186 | 451 | 52.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
agt-PB | 194 | CG1303-PB | 1..194 | 1..194 | 1007 | 100 | Plus |
agt-PA | 194 | CG1303-PA | 1..194 | 1..194 | 1007 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23761-PA | 188 | GI23761-PA | 1..185 | 3..189 | 430 | 51.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22054-PA | 190 | GL22054-PA | 1..190 | 3..192 | 448 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11984-PA | 190 | GA11984-PA | 1..190 | 3..192 | 448 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10537-PA | 191 | GM10537-PA | 1..191 | 3..193 | 893 | 92.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19534-PA | 193 | GD19534-PA | 1..193 | 1..193 | 900 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23945-PA | 190 | GJ23945-PA | 1..186 | 3..189 | 455 | 50.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19164-PA | 189 | GK19164-PA | 1..185 | 3..189 | 459 | 46.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25840-PA | 192 | GE25840-PA | 1..192 | 3..194 | 793 | 80.7 | Plus |