Clone AT04446 Report

Search the DGRC for AT04446

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:44
Well:46
Vector:pOTB7
Associated Gene/Transcriptagt-RA
Protein status:AT04446.pep: gold
Preliminary Size:695
Sequenced Size:698

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1303 2002-01-01 Sim4 clustering to Release 2
CG1303 2002-01-16 Blastp of sequenced clone
CG1303 2003-01-01 Sim4 clustering to Release 3
agt 2008-04-29 Release 5.5 accounting
agt 2008-08-15 Release 5.9 accounting
agt 2008-12-18 5.12 accounting

Clone Sequence Records

AT04446.complete Sequence

698 bp (698 high quality bases) assembled on 2002-01-16

GenBank Submission: AY089255

> AT04446.complete
TCACGAAATTCGTTTAAACTTGACCACGAAATTAAGCGATAAATGACGAT
GTGGATTGGCCAAAACACCCAGATTCGTTTGGTGCCACTAAAGGATCCGC
CAAAGACCATCCGATACAGTTTCCTGGCGACCAAGTTCGGGCAGATGATG
ATGGGAGTGATAAACCCAATATCCGGCGATTCGAAAGACCAAGTCGCAAT
TGGTGTGCTTCACTTCGTGATTAAGGACAATGTGAGTACCTACAATGAAG
TCCAGGAGCGGTGGCCAAAATCCGAACTCTGGAAGGACGATGATGCGGTC
AAGTTGGTGGCGGATAAACTGTTCGAAAGCGACAAGGAAAACTCGCAGGC
GATTCCCATTGCCATCTATGGAACCGACTTCCAGCTGTCCGTATGGCGAG
CTCTGGTGCATATGAAACGAGGGGAGACCTGCACTTACTCCCAACTGGCC
GAGCGGATGGGTCGTCCAACGGCGGTCAGAGCAGTGGCCAGTGCTGTGGC
CAAAAATGAGCTTGCTATCCTCATTCCGTGCCACCGAGTTGTGTCCCAAA
ACGGAGCTTCGAAGTACCACTGGGGCGCAGCCCTCAAGCAACTGCTTCTG
GCCGATGAAAAGTCAAAGAACTATTAAAAATCGTTACTCGTATCTTTATT
GAAACTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT04446.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
agt-RA 693 agt-RA 37..693 1..657 3285 100 Plus
Spase18-21-RA 1039 Spase18-21-RA 917..1039 659..537 615 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2485210..2485866 657..1 3285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6659406..6660064 659..1 3295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6400237..6400895 659..1 3295 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:46:38 has no hits.

AT04446.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:47:50 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2485210..2485866 1..657 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:51:52 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 1..585 43..627 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:10 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 1..585 43..627 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:31 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 1..585 43..627 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:42 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 1..585 43..627 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:07 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 1..585 43..627 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:12:11 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 37..693 1..657 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:10 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 37..693 1..657 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:31 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 37..693 1..657 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:42 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 37..693 1..657 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:07 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
agt-RA 37..693 1..657 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:50 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6659408..6660064 1..657 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:50 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6659408..6660064 1..657 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:50 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6659408..6660064 1..657 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:31 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2485130..2485786 1..657 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:33 Download gff for AT04446.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6400239..6400895 1..657 100   Minus

AT04446.hyp Sequence

Translation from 42 to 626

> AT04446.hyp
MTMWIGQNTQIRLVPLKDPPKTIRYSFLATKFGQMMMGVINPISGDSKDQ
VAIGVLHFVIKDNVSTYNEVQERWPKSELWKDDDAVKLVADKLFESDKEN
SQAIPIAIYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVAS
AVAKNELAILIPCHRVVSQNGASKYHWGAALKQLLLADEKSKNY*

AT04446.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
agt-PA 194 CG1303-PA 1..194 1..194 1007 100 Plus

AT04446.pep Sequence

Translation from 42 to 626

> AT04446.pep
MTMWIGQNTQIRLVPLKDPPKTIRYSFLATKFGQMMMGVINPISGDSKDQ
VAIGVLHFVIKDNVSTYNEVQERWPKSELWKDDDAVKLVADKLFESDKEN
SQAIPIAIYGTDFQLSVWRALVHMKRGETCTYSQLAERMGRPTAVRAVAS
AVAKNELAILIPCHRVVSQNGASKYHWGAALKQLLLADEKSKNY*

AT04446.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17804-PA 186 GF17804-PA 1..184 3..191 578 61.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10335-PA 167 GG10335-PA 1..147 3..149 564 72.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19491-PA 188 GH19491-PA 1..182 3..186 451 52.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
agt-PB 194 CG1303-PB 1..194 1..194 1007 100 Plus
agt-PA 194 CG1303-PA 1..194 1..194 1007 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23761-PA 188 GI23761-PA 1..185 3..189 430 51.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22054-PA 190 GL22054-PA 1..190 3..192 448 45.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11984-PA 190 GA11984-PA 1..190 3..192 448 45.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10537-PA 191 GM10537-PA 1..191 3..193 893 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19534-PA 193 GD19534-PA 1..193 1..193 900 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23945-PA 190 GJ23945-PA 1..186 3..189 455 50.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19164-PA 189 GK19164-PA 1..185 3..189 459 46.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25840-PA 192 GE25840-PA 1..192 3..194 793 80.7 Plus