Clone AT04449 Report

Search the DGRC for AT04449

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:44
Well:49
Vector:pOTB7
Associated Gene/TranscriptCG31128-RA
Protein status:AT04449.pep: gold
Sequenced Size:875

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6844 2002-01-01 Sim4 clustering to Release 2
CG31128 2002-01-16 Blastp of sequenced clone
CG31128 2003-01-01 Sim4 clustering to Release 3
CG31128 2008-04-29 Release 5.5 accounting
CG31128 2008-08-15 Release 5.9 accounting
CG31128 2008-12-18 5.12 accounting

Clone Sequence Records

AT04449.complete Sequence

875 bp (875 high quality bases) assembled on 2002-01-16

GenBank Submission: AY084097

> AT04449.complete
TTTATATTAAGACATGCACACCGGAAAATGTCTGGTAGCATGGATAATTG
TATCTTTATGCTATATAGGACTAGGTGGCGCGTTGAAGGACCTAAAGGAG
GGAAAGATAGCAGAGCCTCTATGCTCAAACTGCAATAAAATTCAGCGCAA
ATGTACCGTCTCCCATTCTGGCCTATTTTGTAAAAATAAAACGGATAAAG
AGAAGATATTGTTTTCACACAGCTTAGCGGAAAAATTGTACAATTTGGAT
GAGTGTGTTCCACACAAGTACAACGTTACGGGTCCGATTTTGGACTGGTG
CTGTCTGTGGTCACCAAAATTGGGCTGCCAGCAATTGGCCGGAATCTACT
ACCAAAACCAATCGCGCTGGAGGGACACCTGCGAAATTTGTCTGCACTCC
TGCATCTGCGATGAGGATACAAACGGGGTGGTCAAGTGCTCTCCCACGGC
TGGCTGCCTGGCTGCCCTGGGCATTCTGGGCATCCTGCTGTCGAGGTCTT
ATCTATGGTCTTGAGATGCGCTGCTTTGCATATCACTGGAAATTCAATAA
GGTTGCCTGCATGGGGGAATTCCGAGTGGCCGGGCACATACCGAAAAACA
AAGTGGCCATTGCACTTAGCCAAGTCGAATACAAATCAAGGCAACAATGG
GTCTGCCACTGTCCCCCAGCGACACGGGGCACATGACTCTGGCCAAAAGG
GGAGCCGTGGCATATCATATTGTTTCTGTTGATTTTATTCGGAATATGCG
ATAGTGGGGAGAGATATTCATAAGTCGAAAACCAATAGTGGCTTTTCAAA
AAAAAAACATTGTTAATTAAAAGCAGACCAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

AT04449.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31128-RA 981 CG31128-RA 66..900 1..835 4175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20293028..20293576 281..829 2745 100 Plus
chr3R 27901430 chr3R 20292694..20292976 1..283 1415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24469762..24470316 281..835 2775 100 Plus
3R 32079331 3R 24469428..24469710 1..283 1415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24210593..24211147 281..835 2775 100 Plus
3R 31820162 3R 24210259..24210541 1..283 1415 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:24:55 has no hits.

AT04449.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:26:05 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20292694..20292974 1..281 100 -> Plus
chr3R 20293029..20293576 282..829 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:51:53 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 1..501 14..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:48:11 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 1..501 14..514 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:41:00 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 1..501 14..514 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:15:43 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 1..501 14..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:33:19 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 1..501 14..514 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:12:13 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 32..860 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:48:11 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 32..860 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:41:00 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 32..860 1..829 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:15:43 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 32..860 1..829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:33:19 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG31128-RA 32..860 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:26:05 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24469428..24469708 1..281 100 -> Plus
3R 24469763..24470310 282..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:26:05 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24469428..24469708 1..281 100 -> Plus
3R 24469763..24470310 282..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:26:05 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24469428..24469708 1..281 100 -> Plus
3R 24469763..24470310 282..829 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:41:00 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20295150..20295430 1..281 100 -> Plus
arm_3R 20295485..20296032 282..829 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:49:34 Download gff for AT04449.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24210259..24210539 1..281 100 -> Plus
3R 24210594..24211141 282..829 100   Plus

AT04449.pep Sequence

Translation from 13 to 513

> AT04449.pep
MHTGKCLVAWIIVSLCYIGLGGALKDLKEGKIAEPLCSNCNKIQRKCTVS
HSGLFCKNKTDKEKILFSHSLAEKLYNLDECVPHKYNVTGPILDWCCLWS
PKLGCQQLAGIYYQNQSRWRDTCEICLHSCICDEDTNGVVKCSPTAGCLA
ALGILGILLSRSYLWS*

AT04449.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19746-PA 154 GF19746-PA 5..129 12..135 284 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:34:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11294-PA 165 GG11294-PA 1..165 1..166 607 72.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31128-PA 166 CG31128-PA 1..166 1..166 928 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:34:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16030-PB 168 GA16030-PB 26..138 24..137 277 46.1 Plus
Dpse\GA30026-PA 167 GA30026-PA 25..161 24..159 221 36.2 Plus
Dpse\GA30027-PA 158 GA30027-PA 22..133 27..132 199 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26600-PA 166 GM26600-PA 1..166 1..166 779 89.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21102-PA 166 GD21102-PA 1..166 1..166 788 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23488-PA 167 GE23488-PA 1..164 1..163 596 72.1 Plus

AT04449.hyp Sequence

Translation from 13 to 513

> AT04449.hyp
MHTGKCLVAWIIVSLCYIGLGGALKDLKEGKIAEPLCSNCNKIQRKCTVS
HSGLFCKNKTDKEKILFSHSLAEKLYNLDECVPHKYNVTGPILDWCCLWS
PKLGCQQLAGIYYQNQSRWRDTCEICLHSCICDEDTNGVVKCSPTAGCLA
ALGILGILLSRSYLWS*

AT04449.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31128-PA 166 CG31128-PA 1..166 1..166 928 100 Plus