Clone AT04468 Report

Search the DGRC for AT04468

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:44
Well:68
Vector:pOTB7
Associated Gene/TranscriptCG5250-RA
Protein status:AT04468.pep: gold
Preliminary Size:936
Sequenced Size:1078

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5250 2002-01-01 Sim4 clustering to Release 2
CG5250 2002-02-26 Blastp of sequenced clone
CG5250 2003-01-01 Sim4 clustering to Release 3
CG5250 2008-04-29 Release 5.5 accounting
CG5250 2008-08-15 Release 5.9 accounting
CG5250 2008-12-18 5.12 accounting

Clone Sequence Records

AT04468.complete Sequence

1078 bp (1078 high quality bases) assembled on 2002-02-26

GenBank Submission: AY089258

> AT04468.complete
CTCATATATTTCCATAAGATATAATTAAGGACCCATATATTATTATTCCA
TGCCTAACGACGCGATAATCTATTCTGGTCCCTACGAATTGGGACGCCTT
CGCCGGCGTCGTGATATGCGGGTGGCGGAGTACCTCTACAGGCGTTCCAT
TCGCACACGCAATGCGGATCCCGAGATGACCGTGTGCCGTTTTATCAAAC
TGCTGCTCTACTTCATCGGATTCTTTTTCGTTCTAGGCGTATTCACAACC
GGATTGGCCCTCGTGATGATTGCGAATCATATATATCCGGATAGGCCGGG
ATGCAAAAAGTTCCCCGGACTAGCAACCGCGCCCGGACACCATGTCGGCG
ATCAGAAGCAAATTATGTGGAGCCCTAATAACATTAAGGATGTGGCTAAC
ATACAACGCGCGATAATGCGAACGGTGAAACGATACGGTCTCGAAGGCCC
GAAGCGCCTGATGGGCTGTAACATAGACGACAGTTGGGGCTATATGTCCG
GCACGCCGTGCATTCTAATAAAGATCACCCAGGCATTGGGCTTCCAGGCG
GTAACCTACGATGACGCCCTAACGCTGCCCGAGTACGCTCCGGATGAGCT
ATTCGACTATGTGGTGGGCCTGGGCTCGGAGGAGCGCTTCAACCGCATCT
GGGTGTCCTGCCAGGTTATTGAGCCAAGAGTGGACATTCAGTTCGACTAC
CATCCGGTTCGCTTCTTCGATGCCGAAGAGCTCTTCACCTCCGGCAATGT
CTTTCTCAACGAGTCTTCGGACGACGACGGACCTACTTACAAGGAGGATC
CCCGCCTCAGGCGCATCATCAGTGTTCGGTTGAGCAACATTCCGATCAAC
GAGGACATCCAAATCCACTGCAAGGCGTGGGCTAAGAACATACCGCTCCA
TATGGTAACGGTCAAGATGCTGGTGCGTCTGACGGCACCAGTTCATCCAA
CCACTCCATTGGTGCTGGACGAGTGGTACGAGTGAGATCAGCTAACTCAG
CTGGATTTATTAATGTATTAATAAATACTTAACAAAATAATAAAACTATT
TGAGAATTATAAAAAAAAAAAAAAAAAA

AT04468.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG5250-RA 1060 CG5250-RA 1..1060 1..1060 5210 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15052155..15053214 1060..1 5210 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:39:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19228216..19229276 1061..1 5215 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18969047..18970107 1061..1 5215 99.4 Minus
Blast to na_te.dros performed on 2019-03-16 05:18:17 has no hits.

AT04468.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:19:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15052155..15053214 1..1060 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:52:01 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..936 50..985 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:35:09 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..936 50..985 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:41:54 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..936 50..985 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:06:58 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..936 50..985 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..936 50..985 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:00:47 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..1014 1..1014 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:35:09 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..1060 1..1060 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:41:54 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..1060 1..1060 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:06:59 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..1014 1..1014 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
CG5250-RA 1..1060 1..1060 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19228217..19229276 1..1060 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19228217..19229276 1..1060 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:19:10 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19228217..19229276 1..1060 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:41:54 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15053939..15054998 1..1060 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:40:51 Download gff for AT04468.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18969048..18970107 1..1060 99   Minus

AT04468.pep Sequence

Translation from 49 to 984

> AT04468.pep
MPNDAIIYSGPYELGRLRRRRDMRVAEYLYRRSIRTRNADPEMTVCRFIK
LLLYFIGFFFVLGVFTTGLALVMIANHIYPDRPGCKKFPGLATAPGHHVG
DQKQIMWSPNNIKDVANIQRAIMRTVKRYGLEGPKRLMGCNIDDSWGYMS
GTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRI
WVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKED
PRLRRIISVRLSNIPINEDIQIHCKAWAKNIPLHMVTVKMLVRLTAPVHP
TTPLVLDEWYE*

AT04468.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18470-PA 313 GF18470-PA 1..303 1..302 855 54.5 Plus
Dana\GF18471-PA 386 GF18471-PA 1..261 1..285 232 24.5 Plus
Dana\GF18472-PA 378 GF18472-PA 1..262 1..283 221 26.8 Plus
Dana\GF14480-PA 309 GF14480-PA 164..289 139..281 147 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16097-PA 311 GG16097-PA 1..311 1..311 1217 74.9 Plus
Dere\GG16108-PA 345 GG16108-PA 1..260 1..283 236 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22396-PA 310 GH22396-PA 1..297 1..296 495 30.6 Plus
Dgri\GH22397-PA 277 GH22397-PA 1..260 1..283 225 24.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5250-PA 311 CG5250-PA 1..311 1..311 1665 100 Plus
CG11703-PA 353 CG11703-PA 1..260 1..283 191 23.4 Plus
CG33310-PB 876 CG33310-PB 659..841 103..281 187 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24482-PA 315 GI24482-PA 1..295 1..294 483 32.9 Plus
Dmoj\GI16930-PA 276 GI16930-PA 95..255 83..281 254 30.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11975-PA 275 GL11975-PA 1..256 45..297 482 36.3 Plus
Dper\GL11976-PA 625 GL11976-PA 90..260 85..283 210 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18763-PA 275 GA18763-PA 1..256 45..297 480 36.3 Plus
Dpse\GA11151-PA 623 GA11151-PA 91..260 86..283 212 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26919-PA 311 GM26919-PA 1..311 1..311 1553 95.5 Plus
Dsec\GM26920-PA 347 GM26920-PA 1..260 1..283 211 25.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20124-PA 311 GD20124-PA 1..311 1..311 1546 94.9 Plus
Dsim\GD20125-PA 347 GD20125-PA 1..260 1..283 210 25.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24547-PA 317 GJ24547-PA 1..295 1..294 518 33.9 Plus
Dvir\GJ17105-PA 274 GJ17105-PA 91..257 86..285 200 28 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18955-PA 306 GK18955-PA 1..299 1..298 564 38.8 Plus
Dwil\GK13483-PA 345 GK13483-PA 82..260 78..285 206 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25143-PA 311 GE25143-PA 1..311 1..311 1295 77.5 Plus
Dyak\GE25144-PA 348 GE25144-PA 1..261 1..284 253 24.8 Plus

AT04468.hyp Sequence

Translation from 49 to 984

> AT04468.hyp
MPNDAIIYSGPYELGRLRRRRDMRVAEYLYRRSIRTRNADPEMTVCRFIK
LLLYFIGFFFVLGVFTTGLALVMIANHIYPDRPGCKKFPGLATAPGHHVG
DQKQIMWSPNNIKDVANIQRAIMRTVKRYGLEGPKRLMGCNIDDSWGYMS
GTPCILIKITQALGFQAVTYDDALTLPEYAPDELFDYVVGLGSEERFNRI
WVSCQVIEPRVDIQFDYHPVRFFDAEELFTSGNVFLNESSDDDGPTYKED
PRLRRIISVRLSNIPINEDIQIHCKAWAKNIPLHMVTVKMLVRLTAPVHP
TTPLVLDEWYE*

AT04468.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:53:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG5250-PA 311 CG5250-PA 1..311 1..311 1665 100 Plus
CG11703-PA 353 CG11703-PA 1..260 1..283 191 23.4 Plus
CG33310-PB 876 CG33310-PB 659..841 103..281 187 25.3 Plus