Clone AT04879 Report

Search the DGRC for AT04879

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:48
Well:79
Vector:pOTB7
Associated Gene/TranscriptCG4270-RA
Protein status:AT04879.pep: gold
Preliminary Size:788
Sequenced Size:671

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4270 2002-01-01 Sim4 clustering to Release 2
CG4270 2002-04-21 Blastp of sequenced clone
CG4270 2003-01-01 Sim4 clustering to Release 3
CG4270 2008-04-29 Release 5.5 accounting
CG4270 2008-08-15 Release 5.9 accounting
CG4270 2008-12-18 5.12 accounting

Clone Sequence Records

AT04879.complete Sequence

671 bp (671 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113205

> AT04879.complete
CTAGCCAGCTAGCTTAAAAAGTCATTAGGCATACGTAAATTTGGTTAACT
AAATCACGGCGCCAGCCAATCCCCCAAAGAAATATGGCGAAGAGAAACGT
AGCGCCCATTCCCAAAACCCACGAGCGCCCTCCAGGTCCCAGGGGTCAGG
ATACCAAGGGCAACAATGAGCTCTTCCTGAAGGAGGTCTTCAATACCACC
AATAAATATCGGGCAATGCACGGCTGTCCCGCGGTGACCATTAATGCTGC
ACTAAATAAGCTGGCTCAGGAATGGGCCAATCATCTCCGCGATCAGAACA
CAATGGCGCACAGACCCAATCCCAAGTATGGCGAAAACATTTTCCTCTCC
GGTGGAATGGATGTGACCGGTGATCTGCCGGTGGAAATGTGGTATCGGGA
AATCAATAGCTACGATTTCAACAAGGCGCAGTTTGTGCCCACCGCTGGAC
ACTTTACTCAGCTCATTTGGAAGTCGTCGGTGGAAATGGGTTCGGGTGTG
GCCCGAAAAGCGGATAGAACTTGGGTGGTTTGCAACTACAATCCTCCCGG
CAATGTTGTGGGTTTGTTCAAGGATAATGTGCCGCCAAAGCAATAACTCT
GGGATTTTTTGATCAAAATTTTAAGCATAATAAAAGCGTAATCTAGGTCC
AGTAAAAAAAAAAAAAAAAAA

AT04879.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG4270-RA 686 CG4270-RA 34..686 1..653 3235 99.6 Plus
CG4270-RB 562 CG4270-RB 12..519 1..508 2510 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2263208..2263488 1..281 1405 100 Plus
chr2L 23010047 chr2L 2263549..2263775 282..508 1135 100 Plus
chr2L 23010047 chr2L 2263830..2263974 509..653 725 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:40:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2263475..2263755 1..281 1390 99.6 Plus
2L 23513712 2L 2263816..2264042 282..508 1120 99.6 Plus
2L 23513712 2L 2264097..2264242 509..654 730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2263475..2263755 1..281 1390 99.6 Plus
2L 23513712 2L 2263816..2264042 282..508 1120 99.5 Plus
2L 23513712 2L 2264097..2264242 509..654 730 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:48:16 has no hits.

AT04879.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:49:30 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2263208..2263488 1..281 100 -> Plus
chr2L 2263549..2263775 282..508 100 -> Plus
chr2L 2263830..2263974 509..653 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:52:46 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 1..513 84..596 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:02 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 1..513 84..596 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:22 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 1..513 84..596 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:59 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 1..513 84..596 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:13:13 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 1..513 84..596 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:37 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 12..662 1..651 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:02 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 12..664 1..653 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:22 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 34..686 1..653 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:59 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 12..662 1..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:13:13 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
CG4270-RA 34..686 1..653 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:30 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2264097..2264241 509..653 100   Plus
2L 2263475..2263755 1..281 99 -> Plus
2L 2263816..2264042 282..508 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:30 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2264097..2264241 509..653 100   Plus
2L 2263475..2263755 1..281 99 -> Plus
2L 2263816..2264042 282..508 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:49:30 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2264097..2264241 509..653 100   Plus
2L 2263475..2263755 1..281 99 -> Plus
2L 2263816..2264042 282..508 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:22 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2263475..2263755 1..281 99 -> Plus
arm_2L 2263816..2264042 282..508 99 -> Plus
arm_2L 2264097..2264241 509..653 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:11 Download gff for AT04879.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2263475..2263755 1..281 99 -> Plus
2L 2263816..2264042 282..508 99 -> Plus
2L 2264097..2264241 509..653 100   Plus

AT04879.pep Sequence

Translation from 83 to 595

> AT04879.pep
MAKRNVAPIPKTHERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPA
VTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPV
EMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVC
NYNPPGNVVGLFKDNVPPKQ*

AT04879.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14614-PA 169 GF14614-PA 3..169 4..170 788 85.6 Plus
Dana\GF18369-PA 173 GF18369-PA 23..156 33..167 283 42.1 Plus
Dana\GF14618-PA 127 GF14618-PA 1..125 45..169 282 45.6 Plus
Dana\GF15289-PA 165 GF15289-PA 45..151 34..140 220 40.2 Plus
Dana\GF17401-PA 396 GF17401-PA 74..187 57..160 141 33.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24843-PA 170 GG24843-PA 1..170 1..170 892 96.5 Plus
Dere\GG24847-PA 141 GG24847-PA 1..137 31..167 303 46.7 Plus
Dere\GG13534-PA 197 GG13534-PA 31..159 40..168 239 41.7 Plus
Dere\GG24536-PA 294 GG24536-PA 151..256 35..140 229 39.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13088-PA 169 GH13088-PA 3..168 4..169 695 75.9 Plus
Dgri\GH13090-PA 167 GH13090-PA 26..167 29..169 352 44.4 Plus
Dgri\GH15654-PA 128 GH15654-PA 2..124 42..167 230 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG4270-PA 170 CG4270-PA 1..170 1..170 934 100 Plus
CG4270-PB 142 CG4270-PB 1..142 1..142 772 100 Plus
CG16995-PA 146 CG16995-PA 6..143 31..168 374 48.6 Plus
CG34049-PB 306 CG34049-PB 149..284 35..170 316 44.1 Plus
CG31482-PA 195 CG31482-PA 28..159 37..168 236 39.3 Plus
CG31286-PB 205 CG31286-PB 32..165 35..170 163 36 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14152-PA 169 GI14152-PA 1..168 1..169 696 74 Plus
Dmoj\GI14160-PA 145 GI14160-PA 6..143 31..168 349 41.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18717-PA 171 GL18717-PA 6..168 7..169 746 81.6 Plus
Dper\GL18718-PA 152 GL18718-PA 2..150 21..169 330 48.7 Plus
Dper\GL21759-PA 134 GL21759-PA 1..127 45..170 232 38.5 Plus
Dper\GL23728-PA 166 GL23728-PA 21..154 31..167 199 30.7 Plus
Dper\GL23137-PA 289 GL23137-PA 74..187 57..160 139 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18072-PA 171 GA18072-PA 6..168 7..169 750 82.2 Plus
Dpse\GA14264-PA 169 GA14264-PA 29..167 31..169 315 49.3 Plus
Dpse\GA16278-PA 134 GA16278-PA 1..127 45..170 235 38.5 Plus
Dpse\GA25572-PA 201 GA25572-PA 30..154 40..167 195 34.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18327-PA 170 GM18327-PA 1..170 1..170 906 98.8 Plus
Dsec\GM18331-PA 146 GM18331-PA 6..143 31..168 325 48.6 Plus
Dsec\GM18243-PA 268 GM18243-PA 153..258 35..140 241 42.5 Plus
Dsec\GM10902-PA 247 GM10902-PA 76..211 33..168 229 38.8 Plus
Dsec\GM10906-PA 205 GM10906-PA 32..163 35..168 160 35.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23143-PA 170 GD23143-PA 1..170 1..170 910 99.4 Plus
Dsim\GD23146-PA 146 GD23146-PA 6..143 31..168 325 48.6 Plus
Dsim\GD22849-PA 268 GD22849-PA 153..258 35..140 242 42.5 Plus
Dsim\GD19881-PA 184 GD19881-PA 13..148 33..168 231 38.8 Plus
Dsim\GD19885-PA 205 GD19885-PA 32..163 35..168 161 35.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17495-PA 126 GJ17495-PA 1..125 45..169 553 77.6 Plus
Dvir\GJ17497-PA 146 GJ17497-PA 4..143 29..168 347 44.3 Plus
Dvir\GJ10085-PA 194 GJ10085-PA 57..190 31..167 301 42 Plus
Dvir\GJ10086-PA 82 GJ10086-PA 1..70 102..170 180 51.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14990-PA 171 GK14990-PA 8..168 9..169 740 83.2 Plus
Dwil\GK15150-PA 141 GK15150-PA 1..140 31..170 323 45 Plus
Dwil\GK15149-PA 175 GK15149-PA 1..118 53..170 268 41.5 Plus
Dwil\GK11578-PA 150 GK11578-PA 4..146 27..167 234 34.5 Plus
Dwil\GK11171-PA 172 GK11171-PA 32..166 31..167 205 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:34:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18084-PA 170 GE18084-PA 1..170 1..170 894 96.5 Plus
Dyak\GE18117-PA 145 GE18117-PA 6..142 31..167 321 47.4 Plus
Dyak\GE15151-PA 295 GE15151-PA 141..276 35..170 298 40.4 Plus
Dyak\GE10229-PA 193 GE10229-PA 31..158 40..168 233 40.3 Plus
Dyak\GE10228-PA 193 GE10228-PA 31..158 40..168 230 39.7 Plus

AT04879.hyp Sequence

Translation from 83 to 595

> AT04879.hyp
MAKRNVAPIPKTHERPPGPRGQDTKGNNELFLKEVFNTTNKYRAMHGCPA
VTINAALNKLAQEWANHLRDQNTMAHRPNPKYGENIFLSGGMDVTGDLPV
EMWYREINSYDFNKAQFVPTAGHFTQLIWKSSVEMGSGVARKADRTWVVC
NYNPPGNVVGLFKDNVPPKQ*

AT04879.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4270-PA 170 CG4270-PA 1..170 1..170 934 100 Plus
CG4270-PB 142 CG4270-PB 1..142 1..142 772 100 Plus
CG16995-PA 146 CG16995-PA 6..143 31..168 374 48.6 Plus
CG34049-PB 306 CG34049-PB 149..284 35..170 316 44.1 Plus
CG31482-PA 195 CG31482-PA 28..159 37..168 236 39.3 Plus