Clone AT05149 Report

Search the DGRC for AT05149

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:51
Well:49
Vector:pOTB7
Associated Gene/TranscriptCG14505-RB
Protein status:AT05149.pep: gold
Preliminary Size:360
Sequenced Size:980

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14505 2002-01-01 Sim4 clustering to Release 2
CG14505 2002-02-22 Blastp of sequenced clone
CG14505 2003-01-01 Sim4 clustering to Release 3
CG14505 2008-04-29 Release 5.5 accounting
CG14505 2008-08-15 Release 5.9 accounting
CG14505 2008-12-18 5.12 accounting

Clone Sequence Records

AT05149.complete Sequence

980 bp (980 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084100

> AT05149.complete
AATTCGTGTTTAGAAATTTCTATGAATGGCTCTCGTCCAGAGTGATGAAA
ACGACTTCCATGCGCTTCGAGAGGCGCAAAGGATGGTGGACTCGTGCCAG
GACTTTGCGGACCACTTGATCGTGGCCGAATTTCTACCCCATTGTCGCGG
CGTGGCCTACATCAATATTCGCACCTTGGAGCAGGTCATCTATTGTGTGC
AACTAAGTCGCGCTGGCTATCGGATCGTGTCCTATGAGTTCGATGATGTG
GCCGATGAGGTGGCCAATTGTGACACTGTCTATGAGTCCGCCCATCAATT
GCTGGCAGGGATAAGTCCGCTGTATGGCGAGAAATATGGCTTTGGACGAG
AGCCACTGGGGAAGCGAAAGGAGAAGCAGTCCTGAGGTAAATGACTTGAT
TGCAATAATAAAGCCCGAAGCTGCGAGTTGGATTCGGGGTCTGCCATTTG
ATTAATTGCTGCCAAGTGAGCACAGACGGTGGGGAGATGCTGGATGCAAG
GAGCAGGAACAGGGGCACGGTTGCCAGTTGATTGACTCAACTTGGCACTC
TCCGGACCTTTTGTAGCGAAAAAAGTTAACAAGTTTTTGTGCTGTTCCAC
TTGACTGCCGCCGTCGAAGGAGGCGAATGAAGATGCAGACGGTTGGAGCT
ACAAGCAACAAGCTACAAGCTTCAAGCCTCGAACACCCAACCAAACCAAT
CCGAACCCAACCCAGCCCAACTCAGTGCCTCTCCAGCCCCACTTGTATTC
CTCATTTTGGCCGGGCACCAAGCCAACTAAGGTTTTTATCTAGTTGAGTC
CATCTAGTCGCTTTTCCGTCCGTCCCACGGGTGTCTGCTGTGGACAATTC
ACAGATACATACACTGAAAACACACAGATGAACAAACGCAAATACAGGCG
AACATCAATAAGAACGCTAGAACTTCAAATACAATGCATGCAATAAAGGT
GAAATTAAAGTGAAAAAAAAAAAAAAAAAA

AT05149.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14505-RB 956 CG14505-RB 1..956 1..962 4405 97.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14189991..14190562 962..385 2600 97.4 Minus
chr2R 21145070 chr2R 14190636..14191023 388..1 1865 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:40:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18302939..18303516 968..385 2525 96.2 Minus
2R 25286936 2R 18303590..18303977 388..1 1880 99 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18304138..18304715 968..385 2560 96.9 Minus
2R 25260384 2R 18304789..18305176 388..1 1880 98.9 Minus
Blast to na_te.dros performed 2019-03-15 17:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 1756..1820 762..700 122 69.7 Minus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 10274..10338 762..700 122 69.7 Minus

AT05149.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:48:11 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14189991..14190560 387..962 97 <- Minus
chr2R 14190638..14191023 1..386 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:52:55 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..360 26..385 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:42:24 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..360 26..385 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:47:20 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RC 1..360 26..385 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:11:13 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..360 26..385 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:47:43 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RC 1..360 26..385 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:07:07 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..956 1..962 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:42:24 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..956 1..962 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:47:20 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..956 1..962 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:11:13 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..956 1..962 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:47:43 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
CG14505-RB 1..956 1..962 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:11 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18302945..18303514 387..962 97 <- Minus
2R 18303592..18303977 1..386 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:11 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18302945..18303514 387..962 97 <- Minus
2R 18303592..18303977 1..386 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:48:11 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18302945..18303514 387..962 97 <- Minus
2R 18303592..18303977 1..386 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:47:20 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14190450..14191019 387..962 97 <- Minus
arm_2R 14191097..14191482 1..386 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:39 Download gff for AT05149.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18304144..18304713 387..962 97 <- Minus
2R 18304791..18305176 1..386 98   Minus

AT05149.hyp Sequence

Translation from 25 to 384

> AT05149.hyp
MALVQSDENDFHALREAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRT
LEQVIYCVQLSRAGYRIVSYEFDDVADEVANCDTVYESAHQLLAGISPLY
GEKYGFGREPLGKRKEKQS*

AT05149.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14505-PB 119 CG14505-PB 1..119 1..119 623 100 Plus
CG14505-PC 119 CG14505-PC 1..119 1..119 623 100 Plus

AT05149.pep Sequence

Translation from 25 to 384

> AT05149.pep
MALVQSDENDFHALREAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRT
LEQVIYCVQLSRAGYRIVSYEFDDVADEVANCDTVYESAHQLLAGISPLY
GEKYGFGREPLGKRKEKQS*

AT05149.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12770-PA 114 GF12770-PA 1..114 1..114 424 70.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20977-PA 116 GG20977-PA 1..116 1..116 598 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16900-PA 144 GH16900-PA 4..115 6..105 135 27.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14505-PB 119 CG14505-PB 1..119 1..119 623 100 Plus
CG14505-PC 119 CG14505-PC 1..119 1..119 623 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16709-PA 130 GL16709-PA 2..107 11..116 284 54.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13037-PA 115 GA13037-PA 2..93 11..102 285 60.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19912-PA 119 GM19912-PA 1..119 1..119 618 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25397-PA 119 GD25397-PA 1..119 1..119 621 98.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13918-PA 116 GE13918-PA 1..116 1..116 588 95.7 Plus