Clone AT05186 Report

Search the DGRC for AT05186

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:51
Well:86
Vector:pOTB7
Associated Gene/TranscriptCG32462-RA
Protein status:AT05186.pep: gold
Sequenced Size:1261

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32462 2003-01-01 Sim4 clustering to Release 3
CG32462 2004-03-31 Blastp of sequenced clone
CG32462 2008-04-29 Release 5.5 accounting
CG32462 2008-08-15 Release 5.9 accounting
CG32462 2008-12-18 5.12 accounting

Clone Sequence Records

AT05186.complete Sequence

1261 bp (1261 high quality bases) assembled on 2004-03-31

GenBank Submission: BT012510

> AT05186.complete
GTAGGCTCTGTCTTTAAGTTCAGTTCAAAATTTTCGTCCGTTAAGCACTT
CCAACACCTTACATTTTTTCGTGACATAAGGAGGGTGCTGGGGAGTCCTT
CCGAAATGTCCTGCTTATTTCGCTGCCCTTTATGCCCTTATAGTTCACAG
TCGCCTTGCATTTATCGTCCATAATGCGGCGCATGCGCACCCACAACTTT
GTGCGAGACATCCTAGTTTCGGAGGGTCCTCCGACGCTAACGCCGAGGTT
TTACATCTTGCCCGATGGAAACAGGTGGCACCTGGAAAATGTGGAAACTG
TGGAAAATTTGCAGCGAGGAGTGTGCCAGTACCGGCGGCATATTAAGGCG
GCTGGGGCAGACTGCTTTGCTGTCAGCGCGGAGCGAGTCAATGACCTGGC
TGACGCCGTCCAACTGTCTGCCGATCTGGAGCCAGCGGCTGGGCCGCAAC
TGCGTCGCTGCTCGGAGCCAGAACTTCGACGTGGAGCTGACGGGACGACT
CTGGTCGCTGTCGGGCGGACTGCATCCGAGGGCTCCTTGGTTCGACCGGA
AGGTGCGTGGGCATCAAACGCTCGGATGCTGCGTGGTGGCCTGTTGTGTG
GCCAGTACATTCCGCCACCTTGGCGAGTGGAGCGGAAAGCTGCTGGACGC
CATCGTGGTTAATGGAAACCGCTACTTCCGCGCCAGCGTGGAGCAGAGCG
AGCGTTGGGACCTTCATTCGGGTGTGGACGATGCCAGGTGCAACTTGAGC
TGGTGGCCTTCGGGCTCCCCAGCCAGTAGAGAAATGAGTTCGCTAGAGGG
CCTCAACTACTTCTTCACGCGCTTTCAGTTTGGCCTGCTGGAGTGCCAGG
AGCGTCGCTTCTCCTTCGGGCACAGCTCCAGCCGCGATGGTGGCTACTTC
CTGTTCGACTGTTCCGCGTGGGCCGAAGCCCTATTCCCGGACGACATGGG
CGCCTTCTACGTGATGCTGGCCAAGCATTTGCAGATGCTACTCTACTGCG
TGGTGGTCACGCTCAATGTGCGGCGCCGAAATGTCGAGTTCCGGCTTTAT
AACGTGGACGTGGCCCGATTGCCCGGTGATGCCCGAAAATGCAGTTGCGA
ATCTGAAGGCGAAAAATGATAAGCCTTAGTTATCTGACCCATTTTGATTT
TATTATAGCCATGCTGACAATATAATTTGATCGAAAGTTCGCCAGGAAGC
AGTATACGAATTCTGTGCGACAAATAAGAGGTACCCCTTAAACAAAAAAA
AAAAAAAAAAA

AT05186.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32462-RA 1239 CG32462-RA 1..1239 1..1239 6180 99.9 Plus
nc_14223.a 1620 nc_14223.a 263..1364 1102..1 5495 99.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22841186..22842428 1243..1 6200 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:40:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22852268..22853512 1245..1 6210 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22845368..22846612 1245..1 6210 99.9 Minus
Blast to na_te.dros performed on 2019-03-15 21:27:40 has no hits.

AT05186.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:28:40 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22841186..22842428 1..1243 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:53:00 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..855 265..1119 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:05 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..855 265..1119 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:48:26 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..855 265..1119 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:51 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..855 265..1119 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:53:51 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..855 265..1119 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:47:17 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..1119 1..1119 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:05 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..1243 1..1243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:48:26 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..1243 1..1243 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:51 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..1119 1..1119 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:53:51 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
CG32462-RA 1..1243 1..1243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:40 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22852270..22853512 1..1243 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:40 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22852270..22853512 1..1243 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:40 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22852270..22853512 1..1243 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:48:26 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22845370..22846612 1..1243 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:16 Download gff for AT05186.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22845370..22846612 1..1243 99   Minus

AT05186.pep Sequence

Translation from 264 to 1118

> AT05186.pep
METGGTWKMWKLWKICSEECASTGGILRRLGQTALLSARSESMTWLTPSN
CLPIWSQRLGRNCVAARSQNFDVELTGRLWSLSGGLHPRAPWFDRKVRGH
QTLGCCVVACCVASTFRHLGEWSGKLLDAIVVNGNRYFRASVEQSERWDL
HSGVDDARCNLSWWPSGSPASREMSSLEGLNYFFTRFQFGLLECQERRFS
FGHSSSRDGGYFLFDCSAWAEALFPDDMGAFYVMLAKHLQMLLYCVVVTL
NVRRRNVEFRLYNVDVARLPGDARKCSCESEGEK*

AT05186.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23623-PA 465 GF23623-PA 7..274 18..263 763 62.7 Plus
Dana\GF10279-PA 1740 GF10279-PA 1468..1721 36..268 533 41.8 Plus
Dana\GF24196-PA 304 GF24196-PA 6..299 21..267 428 34.4 Plus
Dana\GF20952-PA 260 GF20952-PA 12..254 52..264 310 35.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13167-PA 298 GG13167-PA 1..295 12..284 1120 75.9 Plus
Dere\GG16179-PA 1575 GG16179-PA 1304..1557 36..268 526 41.4 Plus
Dere\GG21260-PA 276 GG21260-PA 11..269 37..264 295 33.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14919-PA 1747 GH14919-PA 1473..1726 36..268 503 39.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG32462-PA 284 CG32462-PA 1..284 1..284 1555 100 Plus
CG32436-PA 1737 CG32436-PA 1466..1719 36..268 509 41.8 Plus
CG14402-PB 276 CG14402-PB 11..269 37..264 299 33.1 Plus
CG14402-PA 276 CG14402-PA 11..269 37..264 299 33.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11867-PA 269 GI11867-PA 11..266 22..268 563 47.3 Plus
Dmoj\GI12016-PA 1734 GI12016-PA 1465..1718 36..268 504 39.5 Plus
Dmoj\GI12017-PA 274 GI12017-PA 3..256 36..268 460 38 Plus
Dmoj\GI12018-PA 274 GI12018-PA 6..252 39..266 387 35.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25184-PA 292 GL25184-PA 7..290 17..283 702 50.3 Plus
Dper\GL18679-PA 232 GL18679-PA 7..231 17..219 610 54.7 Plus
Dper\GL24683-PA 2019 GL24683-PA 1465..1584 36..149 302 49.2 Plus
Dper\GL18526-PA 257 GL18526-PA 10..248 67..268 255 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16922-PA 304 GA16922-PA 7..302 17..283 770 53.4 Plus
Dpse\GA16901-PA 1732 GA16901-PA 1465..1731 36..284 504 38.2 Plus
Dpse\GA12957-PA 291 GA12957-PA 23..282 52..268 275 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26927-PB 291 GM26927-PB 3..286 14..276 1167 82 Plus
Dsec\GM26927-PA 183 GM22077-PA 3..152 14..156 644 85.3 Plus
Dsec\GM22362-PA 1523 GM22362-PA 1252..1505 36..268 531 41.8 Plus
Dsec\GM23378-PA 276 GM23378-PA 11..269 37..264 274 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12052-PA 268 GD12052-PA 3..263 14..276 1038 77.2 Plus
Dsim\GD14954-PA 1736 GD14954-PA 1465..1718 36..268 531 41.8 Plus
Dsim\GD24288-PA 276 GD24288-PA 11..269 37..264 277 31.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:34:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13562-PA 285 GJ13562-PA 2..283 22..280 613 50 Plus
Dvir\GJ13285-PA 1736 GJ13285-PA 1467..1720 36..268 497 38.3 Plus
Dvir\GJ13287-PA 272 GJ13287-PA 5..253 39..268 425 37 Plus
Dvir\GJ13286-PA 234 GJ13286-PA 2..215 38..268 339 34.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:34:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20472-PA 1752 GK20472-PA 1474..1727 36..268 523 40.6 Plus
Dwil\GK20498-PA 175 GK20498-PA 21..163 21..156 412 55.9 Plus
Dwil\GK19066-PA 249 GK19066-PA 13..243 53..264 206 29.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19749-PA 1716 GE19749-PA 1467..1698 36..268 404 35.5 Plus
Dyak\GE14649-PA 193 GE14649-PA 1..175 108..268 323 37.5 Plus
Dyak\GE12882-PA 276 GE12882-PA 11..269 37..264 296 31.8 Plus
Dyak\GE14794-PA 135 GE14794-PA 21..99 202..278 281 69.6 Plus
Dyak\GE19489-PA 135 GE19489-PA 21..99 202..278 281 69.6 Plus

AT05186.hyp Sequence

Translation from 264 to 1118

> AT05186.hyp
METGGTWKMWKLWKICSEECASTGGILRRLGQTALLSARSESMTWLTPSN
CLPIWSQRLGRNCVAARSQNFDVELTGRLWSLSGGLHPRAPWFDRKVRGH
QTLGCCVVACCVASTFRHLGEWSGKLLDAIVVNGNRYFRASVEQSERWDL
HSGVDDARCNLSWWPSGSPASREMSSLEGLNYFFTRFQFGLLECQERRFS
FGHSSSRDGGYFLFDCSAWAEALFPDDMGAFYVMLAKHLQMLLYCVVVTL
NVRRRNVEFRLYNVDVARLPGDARKCSCESEGEK*

AT05186.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG32462-PA 284 CG32462-PA 1..284 1..284 1555 100 Plus
CG32436-PA 1737 CG32436-PA 1466..1719 36..268 509 41.8 Plus
CG14402-PB 276 CG14402-PB 11..269 37..264 299 33.1 Plus
CG14402-PA 276 CG14402-PA 11..269 37..264 299 33.1 Plus