Clone AT05679 Report

Search the DGRC for AT05679

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:56
Well:79
Vector:pOTB7
Associated Gene/TranscriptAld-RE
Protein status:AT05679.pep: gold
Sequenced Size:1687

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Ald 2011-02-10 Manual selection by Sue Celniker

Clone Sequence Records

AT05679.complete Sequence

1687 bp assembled on 2011-03-18

GenBank Submission: BT126163.1

> AT05679.complete
CGTATACGAAATTTTAGTCCAAATTTTTAGTTTTATTTTTTACCTCGAAA
TATTTCAAAATTCTGTGCTTACGCAATGGTTTCCAATCATCCGCGCCGCT
GCGGAATTCGATAGCTAGCTTATTAAAACACAATGTCCGCTACTCTTTTT
CATCCAACAAAATAACACCACACCAAATCAAACGTAAATGGATCTTCGTG
CTGCAGAACTACACTCGAATCTCAAAAATGACGACCTACTTCAACTACCC
CAGCAAGGAGCTGCAGGATGAGCTGCGCGAAATCGCCCAGAAAATCGTTG
CCCCCGGCAAGGGAATCCTCGCCGCCGATGAGTCCGGCCCAACCATGGGC
AAGCGTCTGCAGGACATCGGCGTGGAGAACACCGAGGACAACCGCCGTGC
CTACCGTCAGCTGTTGTTCAGCACTGACCCCAAGCTGGCCGAGAACATCT
CTGGAGTGATCCTGTTCCACGAGACCCTCTACCAGAAGGCCGATGATGGC
ACCCCCTTCGCCGAGATCCTGAAGAAGAAGGGAATCATTCTGGGCATCAA
GGTCGACAAGGGTGTTGTCCCACTGTTCGGCTCTGAGGATGAGGTCACCA
CCCAGGGTCTGGATGACCTGGCCGCCCGTTGCGCCCAGTACAAGAAGGAC
GGTTGCGACTTCGCCAAGTGGCGTTGCGTCCTGAAGATCGGCAAGAACAC
CCCATCCTACCAGTCGATCCTGGAGAACGCCAATGTCCTGGCCCGCTACG
CCTCCATCTGCCAGTCGCAGCGCATCGTCCCAATTGTGGAGCCCGAGGTT
CTGCCCGATGGCGATCACGATCTGGACCGCGCCCAGAAGGTCACCGAGAC
CGTCCTGGCCGCCGTCTACAAGGCCCTGAGCGACCACCACGTCTACCTGG
AGGGTACTCTGCTGAAGCCCAACATGGTCACCGCCGGTCAGTCGGCCAAG
AAGAACACCCCCGAGGAGATCGCCCTGGCCACCGTGCAGGCTCTGCGCCG
CACCGTTCCCGCCGCCGTTACTGGCGTGACCTTCCTGTCTGGAGGTCAGT
CCGAGGAGGAGGCCACCGTCAACCTGAGTGCCATCAACAACGTTCCCTTG
ATCCGCCCATGGGCCCTCACCTTCTCGTACGGTCGTGCCCTGCAGGCCTC
CGTCCTGCGTGCCTGGGCTGGCAAGAAGGAGAACATTGCTGCCGGCCAGA
ACGAGCTGCTTAAGCGCGCCAAGGCTAACGGAGAGGCGGCTTGTGGTAAC
TATACAGCTGGATCGGTTAAGGGGTTCGCTGGAAAAGATACTTTGCATGT
GGATGACCACAGGTATTGATCAAAGGATTGAAGAATTGCTGCCTTAAGAT
GGCGATGAACAAGCTTTCATGGGGCCAATTCCCAGGCCTGTCAGGGTATT
TACGTGCCCGGCTCAATTCCGTCGTTTGCCGGCAATGCCAACCTCTTTGT
CGCCCAGCACAAATACTAAGTCCTAAATGCCACGCACTAATCCCGAGTCA
CAATCGAGCGAAGCTATATCCCAAGCCGAATCCAGATAATCCGCAAGAGT
TACTGATCGAGGCCCAGCTGGAGTGAGACGGGCAACATTTATATTCCTCC
AACAATGGAACTGCAAATATATTCCTTTTATACATTTTTACATTTTACCG
AATAAACTGACTAGACCTTAAAAAAAAAAAAAAAAAA

AT05679.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22080278..22081301 1024..1 5045 99.5 Minus
chr3R 27901430 chr3R 22079066..22079362 1669..1373 1470 99.7 Minus
chr3R 27901430 chr3R 22079986..22080191 1224..1019 1000 99 Minus
chr3R 27901430 chr3R 22079527..22079683 1374..1218 770 99.4 Minus
chr3R 27901430 chr3R 22237241..22237860 309..928 505 72.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26257224..26258247 1024..1 5120 100 Minus
3R 32079331 3R 26256004..26256308 1677..1373 1510 99.7 Minus
3R 32079331 3R 26256932..26257137 1224..1019 1015 99.5 Minus
3R 32079331 3R 26256473..26256629 1374..1218 770 99.4 Minus
3R 32079331 3R 26414213..26414832 309..928 505 72.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:09:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25998055..25999078 1024..1 5120 100 Minus
3R 31820162 3R 25996835..25997139 1677..1373 1510 99.6 Minus
3R 31820162 3R 25997763..25997968 1224..1019 1015 99.5 Minus
3R 31820162 3R 25997304..25997460 1374..1218 770 99.3 Minus
3R 31820162 3R 26155305..26155424 570..689 315 84.1 Plus
3R 31820162 3R 26155044..26155132 309..397 160 78.6 Plus
Blast to na_te.dros performed on 2019-03-16 22:38:18 has no hits.

AT05679.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:39:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22079066..22079361 1374..1669 99 <- Minus
chr3R 22079528..22079677 1224..1373 100 <- Minus
chr3R 22079987..22080186 1024..1223 99 <- Minus
chr3R 22080279..22081301 1..1023 99   Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:32 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RI 1..1092 228..1319 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:58:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RE 1..1092 228..1319 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:30:39 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RE 1..1092 228..1319 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:32 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RE 31..1682 1..1652 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:58:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RE 33..1701 1..1669 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:30:39 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RE 33..1701 1..1669 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256933..26257132 1024..1223 100 <- Minus
3R 26256012..26256307 1374..1669 100 <- Minus
3R 26256474..26256623 1224..1373 100 <- Minus
3R 26257225..26258247 1..1023 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256933..26257132 1024..1223 100 <- Minus
3R 26256012..26256307 1374..1669 100 <- Minus
3R 26256474..26256623 1224..1373 100 <- Minus
3R 26257225..26258247 1..1023 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26256933..26257132 1024..1223 100 <- Minus
3R 26256012..26256307 1374..1669 100 <- Minus
3R 26256474..26256623 1224..1373 100 <- Minus
3R 26257225..26258247 1..1023 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:58:23 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22081734..22082029 1374..1669 100 <- Minus
arm_3R 22082196..22082345 1224..1373 100 <- Minus
arm_3R 22082655..22082854 1024..1223 100 <- Minus
arm_3R 22082947..22083969 1..1023 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:02:29 Download gff for AT05679.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25997764..25997963 1024..1223 100 <- Minus
3R 25996843..25997138 1374..1669 100 <- Minus
3R 25997305..25997454 1224..1373 100 <- Minus
3R 25998056..25999078 1..1023 100   Minus

AT05679.hyp Sequence

Translation from 227 to 1318

> AT05679.hyp
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGEAACGNYTAGSVKGF
AGKDTLHVDDHRY*

AT05679.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PI 363 CG6058-PI 1..363 1..363 1861 100 Plus
Ald-PE 363 CG6058-PE 1..363 1..363 1861 100 Plus
Ald-PJ 363 CG6058-PJ 1..363 1..363 1760 95.3 Plus
Ald-PL 363 CG6058-PL 1..363 1..363 1760 95.3 Plus
Ald-PH 363 CG6058-PH 1..363 1..363 1760 95.3 Plus

AT05679.pep Sequence

Translation from 227 to 1318

> AT05679.pep
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGEAACGNYTAGSVKGF
AGKDTLHVDDHRY*

AT05679.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16038-PA 363 GF16038-PA 1..363 1..363 1779 92.6 Plus
Dana\GF20732-PA 364 GF20732-PA 1..357 1..356 1372 70.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12193-PA 363 GG12193-PA 1..363 1..363 1912 98.3 Plus
Dere\GG11473-PA 364 GG11473-PA 1..357 1..356 1357 69.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18178-PA 363 GH18178-PA 1..363 1..363 1665 86.8 Plus
Dgri\GH19415-PA 364 GH19415-PA 1..360 1..359 1386 71.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:14
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PI 363 CG6058-PI 1..363 1..363 1861 100 Plus
Ald-PE 363 CG6058-PE 1..363 1..363 1861 100 Plus
Ald-PJ 363 CG6058-PJ 1..363 1..363 1760 95.3 Plus
Ald-PL 363 CG6058-PL 1..363 1..363 1760 95.3 Plus
Ald-PH 363 CG6058-PH 1..363 1..363 1760 95.3 Plus
Ald-PM 361 CG6058-PM 1..361 1..363 1755 95.9 Plus
Ald-PK 361 CG6058-PK 1..361 1..363 1755 95.9 Plus
Ald-PD 361 CG6058-PD 1..361 1..363 1755 95.9 Plus
Ald-PC 361 CG6058-PC 1..361 1..363 1755 95.9 Plus
Ald-PB 361 CG6058-PB 1..361 1..363 1755 95.9 Plus
CG5432-PB 364 CG5432-PB 1..357 1..356 1289 69.5 Plus
CG5432-PA 364 CG5432-PA 1..357 1..356 1289 69.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10131-PA 361 GI10131-PA 1..342 1..342 1599 87.7 Plus
Dmoj\GI22619-PA 364 GI22619-PA 1..362 1..361 1393 70.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21844-PA 364 GL21844-PA 1..364 1..363 1333 67.6 Plus
Dper\GL22000-PA 319 GL22000-PA 1..178 1..177 758 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19329-PD 363 GA19329-PD 1..363 1..363 1794 93.1 Plus
Dpse\GA19329-PC 361 GA19329-PC 1..361 1..363 1735 90.6 Plus
Dpse\GA19329-PB 363 GA19329-PB 1..363 1..363 1734 90.1 Plus
Dpse\GA18877-PA 364 GA18877-PA 1..364 1..363 1337 67.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10189-PA 363 GM10189-PA 1..363 1..363 1830 95 Plus
Dsec\GM10318-PA 364 GM10318-PA 1..357 1..356 1352 69.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18141-PA 363 GD18141-PA 1..363 1..363 1825 94.8 Plus
Dsim\GD21278-PA 354 GD21278-PA 1..347 1..356 1271 66.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23350-PA 363 GJ23350-PA 1..363 1..363 1651 85.4 Plus
Dvir\GJ23865-PA 364 GJ23865-PA 1..362 1..361 1448 72.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13316-PA 386 GK13316-PA 1..359 1..359 1762 92.8 Plus
Dwil\GK13312-PA 364 GK13312-PA 1..364 1..363 1404 69 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10635-PA 363 GE10635-PA 1..363 1..363 1821 94.5 Plus
Dyak\GE23665-PA 364 GE23665-PA 1..357 1..356 1358 69.5 Plus