Clone AT06125 Report

Search the DGRC for AT06125

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:61
Well:25
Vector:pOTB7
Associated Gene/TranscriptCG6195-RA
Protein status:AT06125.pep: gold
Preliminary Size:1232
Sequenced Size:1360

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6195 2002-01-01 Sim4 clustering to Release 2
CG6195 2002-01-11 Blastp of sequenced clone
CG6195 2003-01-01 Sim4 clustering to Release 3
CG6195 2008-04-29 Release 5.5 accounting
CG6195 2008-08-15 Release 5.9 accounting
CG6195 2008-12-18 5.12 accounting

Clone Sequence Records

AT06125.complete Sequence

1360 bp (1360 high quality bases) assembled on 2002-01-11

GenBank Submission: AY075171

> AT06125.complete
CAACAAACTGCTTTAACTAAAATAATAGGAGAAGCACTGTTAAGATAACT
TCACGGCGTTGCAGTTGTTCCACAGCCGCCCCACTACCTTGACTGCCAAA
AACAGCTGATCGAAATTCCGGGCGACGCACCGCTGGTCAATAAATAAAAG
CGAACATTTGTTTAATTTGAACTTTTGCATGCTCTGCCCCGAACTAAGAG
AGCCAACAGCATGGGCATCCTAGAGAAGATCGCGGAGATCGAGCGCGAGA
TTGCGCGGACGCAGAAGAACAAAGCCACCGAATACCATCTGGGCCTGCTG
AAGGCCAAGTTGGCCAAGTATCGCTCCCAGCTGCTGGAGCCATCCAAGAA
GGGCGAAAAGGGCGACGGATTTGATGTGCTCAAGAGCGGCGACGCCCGGG
TGGCCCTCATTGGCTTTCCCTCCGTGGGGAAGTCCACAATGTTGTCCACT
TTGACCAAAACGGAATCGGAGGCGGCAAACTATGAGTTCACCACTTTGAC
CTGCATTCCGGGTGTCATTGAGTATCAGGGTGCCAATATCCAGTTGCTGG
ATCTGCCCGGAATCATCGAGGGCGCTGCCCAGGGCAAGGGGCGTGGTCGT
CAGGTCATTGCCGTAGCCCGCACCGCTGATTTGGTGCTGATGATGCTGGA
CGCCACCAAGCCCAACGTTCACCGGGAGCTGCTCGAGCGAGAGCTGGAGA
GCGTGGGCATTCGTCTGAACAAGCGCAAGCCCAACATCTACTTCAAGCAG
AAGAAGGGCGGCGGCCTGAGCTTCAACGCCACCTGTTCCCTTACGCGCTG
CAACGAGAAAATGGTCCAGACCATCCTGCACTCCTTCAAGATCTTCAACG
CCGAGGTGCTCTTCCGCGAAGACTGCACCGAGGACGAGTTCATCGACGTG
GTCACCGCCAACCGTGTGTATCTGCCCTGTCTGTATGTCTACAACAAGAT
CGATCAGATCTCCATCGAGGAGGTGGACCGCTTGGCGCGCCAGCCAAACT
CGATAGTGGTTAGTTGCAACATGAAACTTAATCTGGACTACATGATGGAG
GCGCTCTGGGAAGCTCTCCAGCTCATCAGAGTGTACACAAAGAAGCCAGG
CGCTCCTCCAGACTTTGACGATGGATTGATTCTGAGAAAGGGCGTCAGTG
TGGAGCATGTGTGCCATGCCATCCATCGCACGCTGGCGGCGCAGTTCAAG
TATGCCCTGGTGTGGGGCACCTCCACGAAATACTCGCCGCAGCGCGTGGG
GATTGCCCATGTGATGGCCGACGAGGACGTCATCCAGGTGGTGAAGAAAT
AAAGATTGTTGCGTGTGAAATATATATTCTATGCTATAACTGAAAAAAAA
AAAAAAAAAA

AT06125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG6195-RA 1398 CG6195-RA 1..1345 1..1345 6695 99.8 Plus
128up-RA 1499 128up-RA 514..622 516..624 215 79.8 Plus
128up-RA 1499 128up-RA 941..976 943..978 165 97.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:04:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15471045..15471711 1141..475 3335 100 Minus
chr3R 27901430 chr3R 15472062..15472335 274..1 1340 99.3 Minus
chr3R 27901430 chr3R 15470763..15470966 1342..1139 1020 100 Minus
chr3R 27901430 chr3R 15471764..15471966 475..273 1015 100 Minus
chr2R 21145070 chr2R 7925144..7925252 516..624 215 79.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19647212..19647878 1141..475 3335 100 Minus
3R 32079331 3R 19648229..19648502 274..1 1340 99.3 Minus
3R 32079331 3R 19646927..19647133 1345..1139 1035 100 Minus
3R 32079331 3R 19647931..19648133 475..273 1015 100 Minus
2R 25286936 2R 12037922..12038030 516..624 215 79.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19388043..19388709 1141..475 3335 100 Minus
3R 31820162 3R 19389060..19389333 274..1 1340 99.2 Minus
3R 31820162 3R 19387758..19387964 1345..1139 1035 100 Minus
3R 31820162 3R 19388762..19388964 475..273 1015 100 Minus
2R 25260384 2R 12039121..12039229 516..624 215 79.8 Plus
2R 25260384 2R 12039548..12039583 943..978 165 97.2 Plus
Blast to na_te.dros performed on 2019-03-16 19:04:55 has no hits.

AT06125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:05:55 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15470763..15470964 1141..1342 100 <- Minus
chr3R 15471046..15471710 476..1140 100 <- Minus
chr3R 15471764..15471964 275..475 100 <- Minus
chr3R 15472062..15472335 1..274 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:53:57 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1092 211..1302 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:50:11 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1092 211..1302 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:32:04 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1092 211..1302 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:16:54 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1092 211..1302 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:00 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1092 211..1302 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:14:04 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1342 1..1342 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:50:11 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1342 1..1342 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:32:04 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1342 1..1342 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:16:55 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1342 1..1342 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:00 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
CG6195-RA 1..1250 93..1342 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:55 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648229..19648502 1..274 99   Minus
3R 19646930..19647131 1141..1342 100 <- Minus
3R 19647213..19647877 476..1140 100 <- Minus
3R 19647931..19648131 275..475 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:55 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648229..19648502 1..274 99   Minus
3R 19646930..19647131 1141..1342 100 <- Minus
3R 19647213..19647877 476..1140 100 <- Minus
3R 19647931..19648131 275..475 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:05:55 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19648229..19648502 1..274 99   Minus
3R 19646930..19647131 1141..1342 100 <- Minus
3R 19647213..19647877 476..1140 100 <- Minus
3R 19647931..19648131 275..475 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:32:04 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15472652..15472853 1141..1342 100 <- Minus
arm_3R 15472935..15473599 476..1140 100 <- Minus
arm_3R 15473653..15473853 275..475 100 <- Minus
arm_3R 15473951..15474224 1..274 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:50:57 Download gff for AT06125.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19388044..19388708 476..1140 100 <- Minus
3R 19388762..19388962 275..475 100 <- Minus
3R 19389060..19389333 1..274 99   Minus
3R 19387761..19387962 1141..1342 100 <- Minus

AT06125.hyp Sequence

Translation from 210 to 1301

> AT06125.hyp
MGILEKIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEPSKKGEK
GDGFDVLKSGDARVALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIP
GVIEYQGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLDATK
PNVHRELLERELESVGIRLNKRKPNIYFKQKKGGGLSFNATCSLTRCNEK
MVQTILHSFKIFNAEVLFREDCTEDEFIDVVTANRVYLPCLYVYNKIDQI
SIEEVDRLARQPNSIVVSCNMKLNLDYMMEALWEALQLIRVYTKKPGAPP
DFDDGLILRKGVSVEHVCHAIHRTLAAQFKYALVWGTSTKYSPQRVGIAH
VMADEDVIQVVKK*

AT06125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6195-PA 363 CG6195-PA 1..363 1..363 1853 100 Plus
128up-PA 368 CG8340-PA 4..367 3..363 1056 56.3 Plus
CG13390-PA 381 CG13390-PA 206..319 62..172 191 40.4 Plus

AT06125.pep Sequence

Translation from 210 to 1301

> AT06125.pep
MGILEKIAEIEREIARTQKNKATEYHLGLLKAKLAKYRSQLLEPSKKGEK
GDGFDVLKSGDARVALIGFPSVGKSTMLSTLTKTESEAANYEFTTLTCIP
GVIEYQGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADLVLMMLDATK
PNVHRELLERELESVGIRLNKRKPNIYFKQKKGGGLSFNATCSLTRCNEK
MVQTILHSFKIFNAEVLFREDCTEDEFIDVVTANRVYLPCLYVYNKIDQI
SIEEVDRLARQPNSIVVSCNMKLNLDYMMEALWEALQLIRVYTKKPGAPP
DFDDGLILRKGVSVEHVCHAIHRTLAAQFKYALVWGTSTKYSPQRVGIAH
VMADEDVIQVVKK*

AT06125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17362-PA 363 GF17362-PA 1..363 1..363 1921 98.3 Plus
Dana\GF12286-PA 368 GF12286-PA 4..367 3..363 1089 56 Plus
Dana\GF14685-PA 376 GF14685-PA 205..318 62..172 179 40.4 Plus
Dana\GF15477-PA 383 GF15477-PA 158..244 62..147 155 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15886-PA 363 GG15886-PA 1..363 1..363 1936 99.4 Plus
Dere\GG20239-PA 368 GG20239-PA 4..367 3..363 1081 55.8 Plus
Dere\GG23451-PA 381 GG23451-PA 206..319 62..172 194 40.4 Plus
Dere\GG21611-PA 383 GG21611-PA 158..244 62..147 152 39.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23383-PA 363 GH23383-PA 1..363 1..363 1905 97.5 Plus
Dgri\GH20854-PA 368 GH20854-PA 4..367 3..363 1094 55.8 Plus
Dgri\GH10882-PA 375 GH10882-PA 198..311 62..172 189 38.6 Plus
Dgri\GH13046-PA 383 GH13046-PA 158..244 62..147 157 40.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:13:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG6195-PA 363 CG6195-PA 1..363 1..363 1853 100 Plus
128up-PA 368 CG8340-PA 4..367 3..363 1056 56.3 Plus
CG13390-PA 381 CG13390-PA 206..319 62..172 191 40.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10336-PA 367 GI10336-PA 1..367 1..363 1898 96.7 Plus
Dmoj\GI20960-PA 368 GI20960-PA 4..367 3..363 1090 56 Plus
Dmoj\GI12998-PA 372 GI12998-PA 198..311 62..172 198 41.2 Plus
Dmoj\GI18192-PA 384 GI18192-PA 159..245 62..147 156 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11955-PA 343 GL11955-PA 1..343 1..363 1769 92.3 Plus
Dper\GL17092-PA 368 GL17092-PA 4..367 3..363 1092 56 Plus
Dper\GL11553-PA 241 GL11553-PA 4..151 3..153 433 62.1 Plus
Dper\GL11553-PA 241 GL11553-PA 134..221 210..297 254 47.7 Plus
Dper\GL25811-PA 382 GL25811-PA 207..320 62..172 186 40.4 Plus
Dper\GL25622-PA 383 GL25622-PA 158..244 62..147 159 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19430-PA 363 GA19430-PA 1..363 1..363 1910 97.8 Plus
Dpse\GA21003-PA 368 GA21003-PA 4..367 3..363 1092 56 Plus
Dpse\GA24766-PA 150 GA24766-PA 4..143 3..140 449 66.4 Plus
Dpse\GA24767-PA 102 GA24767-PA 13..82 228..297 210 50 Plus
Dpse\GA12249-PA 382 GA12249-PA 207..320 62..172 186 40.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26898-PA 363 GM26898-PA 1..363 1..363 1943 100 Plus
Dsec\GM21327-PA 368 GM21327-PA 4..367 3..363 1083 55.8 Plus
Dsec\GM12999-PA 381 GM12999-PA 206..319 62..172 193 40.4 Plus
Dsec\GM16989-PA 383 GM16989-PA 158..244 62..147 154 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20106-PA 363 GD20106-PA 1..363 1..363 1943 100 Plus
Dsim\GD10834-PA 353 GD10834-PA 4..352 3..363 949 50.5 Plus
Dsim\GD22413-PA 381 GD22413-PA 206..319 62..172 192 40.4 Plus
Dsim\GD21736-PA 383 GD21736-PA 158..244 62..147 154 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10190-PA 363 GJ10190-PA 1..363 1..363 1912 98.1 Plus
Dvir\GJ20681-PA 368 GJ20681-PA 4..367 3..363 1089 55.8 Plus
Dvir\GJ11528-PA 376 GJ11528-PA 198..311 62..172 192 39.5 Plus
Dvir\GJ14682-PA 383 GJ14682-PA 158..244 62..147 158 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22817-PA 363 GK22817-PA 1..363 1..363 1914 98.3 Plus
Dwil\GK21337-PA 368 GK21337-PA 4..367 3..363 1090 55.5 Plus
Dwil\GK24168-PA 380 GK24168-PA 205..318 62..172 181 38.6 Plus
Dwil\GK15220-PA 384 GK15220-PA 159..245 62..147 154 39.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:52:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25118-PA 363 GE25118-PA 1..363 1..363 1939 99.7 Plus
Dyak\GE12398-PA 368 GE12398-PA 4..367 3..363 1083 55.8 Plus
Dyak\GE11035-PA 384 GE11035-PA 206..319 62..172 195 40.4 Plus
Dyak\GE12631-PA 383 GE12631-PA 158..261 62..159 156 38.5 Plus