Clone AT06251 Report

Search the DGRC for AT06251

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:62
Well:51
Vector:pOTB7
Associated Gene/TranscriptCG5478-RA
Protein status:AT06251.pep: gold
Preliminary Size:792
Sequenced Size:1054

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5478 2002-01-01 Sim4 clustering to Release 2
CG5478 2002-02-22 Blastp of sequenced clone
CG5478 2003-01-01 Sim4 clustering to Release 3
CG5478 2008-04-29 Release 5.5 accounting
CG5478 2008-08-15 Release 5.9 accounting
CG5478 2008-12-18 5.12 accounting

Clone Sequence Records

AT06251.complete Sequence

1054 bp (1054 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089266

> AT06251.complete
ATTTGTCAGTTATCGTTTTTAAAAATTCGAAATTCCCTAGTTAAGCCAAT
GATTCAGGAACCGAACTGGAAAAAGGACTACGACCGTCTGGTCCGCGAGC
ATTTGAATGATCAGAATCAGACGAAGTCGCTACAACGACAAATACGGCAT
TTTCGCTCAAAGCGCGTACGACTCCAGAATGAAATCGAGGCGGAGAGCAG
GAGCATGGACGTTTGGGTAAAGATGATGGAGAACTTGCACCGCGGAGTGG
AGCGCTTTCAGAAGCACCACCACCTGCTCACGCCCAAAAAGCGCAAGCAG
CTGCGCCGCATAATGCGAAAGCTGCCCTTGAGCAGTTTGGATGAGCAGGT
GCGACTGATGGAGGTGTCGGAGCGGTTGGTGCCCAAGCCGTGCAAGGAGA
CTCCTGAACCACCGAAGGGCAACGAACGCCAGTTCATCAAGTACTCAGTT
CCGCATCAGAAAAAGAACTGTGATCCTAATAATCAATCCCCCGTGGACAA
ACGGCTGGCCAGGATATATGCCAATCTGAAGGCTCTGCTAAAAATCCACG
AGCAGACCTCGTCCGTCATCGCTGATATACATTCCCTGATCGCCACTATT
AACTATTTGGAGCGGGGGCACTGCACCAAGATAAAGATCACTCCAGCGGA
GGGCTCCAGGCCGTCAATAAAGGCTACCATCGAATTGGATCGGCTGCGCA
AGACCAAGCACGGCAACCACTACACGCGGGAAATTATGGACGTACGTCCT
CCGTACATCCTTGACCATGTGCCGCAATTGAAACCAAACATTTTCGACGC
TCTGGGGAGAAAGGCGAAAAAATCAAAATCCAAGCACTGAACCGTTTCTG
GTGGGGAAAATAATTTATTACTCCAAGAATTAGTCTACTTAGACATAGTC
TACTGAACATGCTCTATGCTACGCTAGTTCTGTCCTGCGTCAGTTTGATA
TATACAATTTACAATAATCTCATTTAGCTCGGGCAAAGTGGTGGCTGATT
ACAGAGAACAATTTAAATTATATCCAAACCAATAGAAAAAAAAAAAAAAA
AAAA

AT06251.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5478-RA 1035 CG5478-RA 1..1035 1..1035 5175 100 Plus
CG4221-RA 3250 CG4221-RA 3031..3250 1036..817 1100 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:06:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11757292..11758326 1035..1 5175 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15932699..15933734 1036..1 5180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15673530..15674565 1036..1 5180 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:06:07 has no hits.

AT06251.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:07:12 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11757292..11758326 1..1035 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:54:07 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..792 49..840 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:43:13 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..792 49..840 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:41:09 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..792 49..840 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:11:44 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..792 49..840 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:09:21 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..792 49..840 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:07:50 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..1035 1..1035 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:43:13 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..1035 1..1035 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:41:09 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..1035 1..1035 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:11:44 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..1035 1..1035 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:09:21 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
CG5478-RA 1..1035 1..1035 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:12 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15932700..15933734 1..1035 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:12 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15932700..15933734 1..1035 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:12 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15932700..15933734 1..1035 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:41:09 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11758422..11759456 1..1035 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:46:14 Download gff for AT06251.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15673531..15674565 1..1035 100   Minus

AT06251.hyp Sequence

Translation from 1 to 839

> AT06251.hyp
ICQLSFLKIRNSLVKPMIQEPNWKKDYDRLVREHLNDQNQTKSLQRQIRH
FRSKRVRLQNEIEAESRSMDVWVKMMENLHRGVERFQKHHHLLTPKKRKQ
LRRIMRKLPLSSLDEQVRLMEVSERLVPKPCKETPEPPKGNERQFIKYSV
PHQKKNCDPNNQSPVDKRLARIYANLKALLKIHEQTSSVIADIHSLIATI
NYLERGHCTKIKITPAEGSRPSIKATIELDRLRKTKHGNHYTREIMDVRP
PYILDHVPQLKPNIFDALGRKAKKSKSKH*

AT06251.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG5478-PA 263 CG5478-PA 1..263 17..279 1381 100 Plus

AT06251.pep Sequence

Translation from 48 to 839

> AT06251.pep
MIQEPNWKKDYDRLVREHLNDQNQTKSLQRQIRHFRSKRVRLQNEIEAES
RSMDVWVKMMENLHRGVERFQKHHHLLTPKKRKQLRRIMRKLPLSSLDEQ
VRLMEVSERLVPKPCKETPEPPKGNERQFIKYSVPHQKKNCDPNNQSPVD
KRLARIYANLKALLKIHEQTSSVIADIHSLIATINYLERGHCTKIKITPA
EGSRPSIKATIELDRLRKTKHGNHYTREIMDVRPPYILDHVPQLKPNIFD
ALGRKAKKSKSKH*

AT06251.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16468-PA 274 GF16468-PA 5..264 7..254 595 49.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20256-PA 267 GG20256-PA 1..267 1..263 1088 77.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG5478-PA 263 CG5478-PA 1..263 1..263 1381 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21724-PA 257 GL21724-PA 8..250 6..257 320 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18911-PA 255 GA18911-PA 8..248 6..257 309 30 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25742-PA 262 GM25742-PA 1..262 1..263 1287 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20316-PA 262 GD20316-PA 1..262 1..263 1296 93.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23459-PA 238 GJ23459-PA 9..236 7..252 183 26.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19205-PA 259 GK19205-PA 5..253 7..254 280 29.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26346-PA 268 GE26346-PA 1..268 1..263 1043 75 Plus