Clone AT06280 Report

Search the DGRC for AT06280

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:62
Well:80
Vector:pOTB7
Associated Gene/TranscriptCG42675-RD
Protein status:AT06280.pep: gold
Sequenced Size:650

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10999-RC 2009-06-22 Replacement based on scoring

Clone Sequence Records

AT06280.complete Sequence

650 bp assembled on 2009-07-28

GenBank Submission: BT088966.1

> AT06280.complete
TTTTAAATGTCTGTTTCCAACAAGGCGGAACCCAAATCACCAGTTAAAAA
GGTCAACATGGACACAACGACTGCAATCCCAGAGGGCACCGCTTTATGCC
GCTACTGCGGACGCCACTTCAACACGGATCGTCTGGCGAAGCACGAGGAG
GTGTGCCAGCGCATGCTGACCACCAAACGCAAGATATTCGATGCCTCCAA
GCAGCGGATCGAGGGCACCGAGGCCGCGGCGTTCAATATGAAGTCGAAGG
GCAATCGCAACCGTTCAACTTACAGTAGTGCTGCCCAGCAGAAGGGTCTG
ACCACTGGAGTGAAGAAGAACAACTGGCGTAAGAAGCACGAGGACTTCAT
TCAGTCGATTAGAGCGGCCAAGCAGGTGAAGGCGCACTTGGCGCGCGGCG
GCAAGTTGAGCGACCTGCCACCACCGCCACCTTCGGAGAATCCAGACTAT
GTCCAGTGTCCCCACTGTGGTCGCCGATTCAACGAACAGGCTGCGGAGCG
TCATATCCCCAAGTGCGTTAACATGGTGCACAACAAGCCCCGTAACGGTC
CGCCGGCCAAGAGGCGTTGAGTGGTGATTGGGAATAGATATTCGCCCATT
CTTTTACTTGTGATAAAGAAGTTTTATGATTGAAAAAAAAAAAAAAAAAA

AT06280.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10999-RC 652 CG10999-RC 13..647 1..635 3175 100 Plus
CG10999-RB 1773 CG10999-RB 1157..1768 24..635 3060 100 Plus
CG10999-RA 1724 CG10999-RA 1108..1719 24..635 3060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1643895..1644467 60..632 2865 100 Plus
chr3R 27901430 chr3R 1643775..1643835 1..61 305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5818248..5818823 60..635 2880 100 Plus
3R 32079331 3R 5818128..5818188 1..61 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5559079..5559654 60..635 2880 100 Plus
3R 31820162 3R 5558959..5559019 1..61 305 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:09:51 has no hits.

AT06280.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:11:01 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1643775..1643834 1..60 100 -> Plus
chr3R 1643896..1644467 61..632 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:03 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG10999-RC 1..564 7..570 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:40 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 1..564 7..570 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:53:50 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 1..564 7..570 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:24:24 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 1..564 7..570 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 16:37:03 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG10999-RC 13..644 1..632 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:40 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 13..644 1..632 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:53:50 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 13..644 1..632 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:24:24 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
CG42675-RD 13..644 1..632 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:01 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5818128..5818187 1..60 100 -> Plus
3R 5818249..5818820 61..632 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:01 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5818128..5818187 1..60 100 -> Plus
3R 5818249..5818820 61..632 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:01 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5818128..5818187 1..60 100 -> Plus
3R 5818249..5818820 61..632 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:53:50 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1643850..1643909 1..60 100 -> Plus
arm_3R 1643971..1644542 61..632 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:32 Download gff for AT06280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5559080..5559651 61..632 100   Plus
3R 5558959..5559018 1..60 100 -> Plus

AT06280.hyp Sequence

Translation from 6 to 569

> AT06280.hyp
MSVSNKAEPKSPVKKVNMDTTTAIPEGTALCRYCGRHFNTDRLAKHEEVC
QRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTT
GVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQ
CPHCGRRFNEQAAERHIPKCVNMVHNKPRNGPPAKRR*

AT06280.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42675-PD 187 CG10999-PC 1..187 1..187 1004 100 Plus
CG42675-PF 383 CG42675-PF 202..383 6..187 978 99.5 Plus
CG42675-PC 383 CG10999-PB 202..383 6..187 978 99.5 Plus
CG42675-PB 383 CG10999-PA 202..383 6..187 978 99.5 Plus
CG42675-PE 412 CG42675-PE 231..412 6..187 978 99.5 Plus

AT06280.pep Sequence

Translation from 6 to 569

> AT06280.pep
MSVSNKAEPKSPVKKVNMDTTTAIPEGTALCRYCGRHFNTDRLAKHEEVC
QRMLTTKRKIFDASKQRIEGTEAAAFNMKSKGNRNRSTYSSAAQQKGLTT
GVKKNNWRKKHEDFIQSIRAAKQVKAHLARGGKLSDLPPPPPSENPDYVQ
CPHCGRRFNEQAAERHIPKCVNMVHNKPRNGPPAKRR*

AT06280.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:18:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16356-PA 389 GF16356-PA 204..388 6..187 700 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13059-PA 382 GG13059-PA 201..382 6..187 878 91.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:18:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13179-PA 380 GH13179-PA 195..373 5..183 671 70.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42675-PD 187 CG10999-PC 1..187 1..187 1004 100 Plus
CG42675-PF 383 CG42675-PF 202..383 6..187 978 99.5 Plus
CG42675-PC 383 CG10999-PB 202..383 6..187 978 99.5 Plus
CG42675-PB 383 CG10999-PA 202..383 6..187 978 99.5 Plus
CG42675-PE 412 CG42675-PE 231..412 6..187 978 99.5 Plus
CG42675-PG 427 CG42675-PG 246..427 6..187 978 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22365-PA 424 GI22365-PA 237..417 6..183 692 72.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24325-PA 466 GL24325-PA 283..460 6..182 666 75.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26574-PA 380 GA26574-PA 197..374 6..182 669 74.4 Plus
Dpse\GA26574-PB 423 GA26574-PB 240..417 6..182 668 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10844-PA 383 GM10844-PA 202..383 6..187 978 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19826-PA 455 GD19826-PA 271..455 3..187 936 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:18:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24399-PA 385 GJ24399-PA 203..374 9..179 676 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22541-PA 461 GK22541-PA 277..456 6..183 653 72.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10169-PA 378 GE10169-PA 194..378 3..187 877 90.8 Plus