Clone AT06648 Report

Search the DGRC for AT06648

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:66
Well:48
Vector:pOTB7
Associated Gene/TranscriptCG11756-RA
Protein status:AT06648.pep: gold
Preliminary Size:612
Sequenced Size:764

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11756 2002-01-01 Sim4 clustering to Release 2
CG11756 2002-04-26 Blastp of sequenced clone
CG11756 2003-01-01 Sim4 clustering to Release 3
CG11756 2008-04-29 Release 5.5 accounting
CG11756 2008-08-15 Release 5.9 accounting
CG11756 2008-12-18 5.12 accounting

Clone Sequence Records

AT06648.complete Sequence

764 bp (764 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113211

> AT06648.complete
TCACATTTCTCGATCGTCAGAAATAAAATCGGAGCTTATGCGTCGCTTGC
AATTATTTTAAATTCTTAGTAAACTTTCTTGGAAAATGCTTAAATATTTG
GCTGGAATTTTCGTCAGTCCGCGCAATGACTACGCGAATGGTCGCTACAG
GATTCCGCATCCGAAGAAGCTGGCCGCCAGGCGAAAGTCGCCCCCGGTGA
ATATATCCACGAGGAGCGTCATCAATGGCGGCAGGTCGGCAAACGGGAGG
CTCAAGACGGAAAATAGAAACGCACGGCGACGTCGAGAGGGCAATCCACA
TCTGACGCGACCACACAGCCGATCCTCCCAGAAAACCATAGGGATCCGCC
TGGATCCCATTAGCTACATCGTAAATGTGCCCAATTCCACTTCATCGCCC
GACGACGACGAGGAGGAGGTGCCTGTACCGCAATTGCCCAACGCAGTAAA
CAAACTGAAGGCTCGAACGTATCGGAAGGAGAATTCCGATTGCCTTATTC
CACCGCCAGTTAGTCGCGTCGCGAGTTGGTCGGGTCCTTTGAATGCCAGT
CCCTTCAACCAGCTGGATGAGCAGAATTCCATCTCTGACGATGCGGACGC
AATGGGCTGGAAAGCGATTTGTTTGCCAGATGATTTTTGGTCGGAGGATT
CGGACTCGGAAAGCAAAAGCAAAATGAGTAAAATCAATGTCTTTTAATAT
ACAAAAAATTTATTTTAAATATTATAATAGTTGACCATTCAATAAGAAAA
AAAAAAAAAAAAAA

AT06648.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11756-RA 747 CG11756-RA 1..747 1..747 3735 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11239264..11240009 1..746 3730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11348120..11348866 1..747 3735 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11356218..11356964 1..747 3735 100 Plus
Blast to na_te.dros performed 2019-03-16 07:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 8435..8500 660..727 127 71 Plus

AT06648.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:18:56 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11239264..11240009 1..746 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:54:09 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..612 86..697 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:01 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..612 86..697 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:39:51 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..612 86..697 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:22 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..612 86..697 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:02 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..612 86..697 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:45 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:01 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:39:51 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:22 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..746 1..746 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:02 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
CG11756-RA 1..746 1..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:56 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
X 11348120..11348865 1..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:56 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
X 11348120..11348865 1..746 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:18:56 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
X 11348120..11348865 1..746 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:39:51 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11242153..11242898 1..746 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:15 Download gff for AT06648.complete
Subject Subject Range Query Range Percent Splice Strand
X 11356218..11356963 1..746 100   Plus

AT06648.hyp Sequence

Translation from 85 to 696

> AT06648.hyp
MLKYLAGIFVSPRNDYANGRYRIPHPKKLAARRKSPPVNISTRSVINGGR
SANGRLKTENRNARRRREGNPHLTRPHSRSSQKTIGIRLDPISYIVNVPN
STSSPDDDEEEVPVPQLPNAVNKLKARTYRKENSDCLIPPPVSRVASWSG
PLNASPFNQLDEQNSISDDADAMGWKAICLPDDFWSEDSDSESKSKMSKI
NVF*

AT06648.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG11756-PA 203 CG11756-PA 1..203 1..203 1069 100 Plus

AT06648.pep Sequence

Translation from 85 to 696

> AT06648.pep
MLKYLAGIFVSPRNDYANGRYRIPHPKKLAARRKSPPVNISTRSVINGGR
SANGRLKTENRNARRRREGNPHLTRPHSRSSQKTIGIRLDPISYIVNVPN
STSSPDDDEEEVPVPQLPNAVNKLKARTYRKENSDCLIPPPVSRVASWSG
PLNASPFNQLDEQNSISDDADAMGWKAICLPDDFWSEDSDSESKSKMSKI
NVF*

AT06648.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18404-PA 190 GG18404-PA 1..190 1..184 553 62.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG11756-PA 203 CG11756-PA 1..203 1..203 1069 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11470-PA 203 GM11470-PA 1..203 1..203 889 83.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17012-PA 203 GD17012-PA 1..203 1..203 897 84.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15923-PA 205 GE15923-PA 1..203 1..196 569 64.3 Plus