Clone AT07283 Report

Search the DGRC for AT07283

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:72
Well:83
Vector:pOTB7
Associated Gene/TranscriptFancl-RA
Protein status:AT07283.pep: gold
Preliminary Size:1143
Sequenced Size:1244

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12812 2002-01-01 Sim4 clustering to Release 2
CG12812 2002-01-03 Blastp of sequenced clone
CG12812 2003-01-01 Sim4 clustering to Release 3
Fancl 2008-04-29 Release 5.5 accounting
Fancl 2008-08-15 Release 5.9 accounting
CG3925 2008-08-15 Release 5.9 accounting
Fancl 2008-12-18 5.12 accounting
CG3925 2008-12-18 5.12 accounting

Clone Sequence Records

AT07283.complete Sequence

1244 bp (1244 high quality bases) assembled on 2002-01-03

GenBank Submission: AY075174

> AT07283.complete
CAAAAGTCATTCAAGCACAATCTGACCAAAATCAAATATAATGGAAAGTA
ACGAAGATGTAGAGCGCCTTCTGTGTCAAAAGTATCCTGGTCTGGCAGCG
GAGCTTCAGCCAAGTGGAGCGTGCATCATCAGAGGAGTTTTGGGCAGTGA
GGATACATGGCGCCGCCTTAAACTCTATCTGCCACACCACCCAGCTCTTC
ATGGTTTCCAGCTCTACGTCCAGGAAAGCTTGGAGTACAAGCTGTACACA
TCGGCTAATCTCAAGTTACAGGACGATTGGCTGCTGGAGGATTTTCTGGA
CCATTTGCCAAAGATTCTTCCTGCCCAAAAAGCCCCAACAGTGCCAAAGG
AACTATGTCGGGAGGGGAACATATATTACGATATCCTGGCCTTGTACAAG
TCAAACGAGTACTGCCTGCAAGTGGACGAGGCCTGTTCCATGATTCGTTT
CAGCGAATTCACCGACTTCGAGCAGCATTATCTGGAGCTTAAGATCCCGT
CTCTTCTCTTGCTTGATCACAGTTTGCCCGACTGCGTATCGCTGGGTGAA
ATGCTGACCAAGAGTGCTGGAAACCTAGAGGAGGCCCTAAACCTCTTTCG
CAAGCTTCTCGAGGATCTGCGTCCCTTCTACGACAACTTCATGGATATCG
ACGAGCTTTGTCATGTGCTGCAACCATCGCCCATCAGCAGCAAACACAAA
ACACGACTGTTCCCTCTCAAGGATCGCGTCTACTTGAAGCTGACCATCGC
GGATCCCTTTGCCTGCATTGCATCCATGTCGCTAAAGATCATTGGGCCCA
CGGAAGAGGTGGCCCGCCTGCGCCACGTTCTCAGCGATGGTCTAAGTAAC
TGGGACTCCGAAATGAACATTCACAAGAACCTACTCCGAATGTTCGACTT
GTGCTACTTTCCCATGCCAGACTGGTCGGATGGACCCAAGCTGGATGAAG
AGGACAACGAAGAGCTGCGCTGTAACATTTGCTTTGCCTATCGCCTGGAT
GGTGGCGAGGTGCCCCTCGTCTCCTGCGACAATGCCAAATGTGTGCTAAA
GTGCCATGCCGTCTGTTTGGAGGAGTGGTTTAAGACTCTGATGGATGGCA
AGACCTTTCTGGAGGTCTCCTTCGGCCAGTGTCCCTTCTGCAAGGCGAAG
CTGTCCACCTCATTTGCGGCACTTTTAAATGATTGAAATTTGTAACCATA
ATATTAAAAGCAAATATTTAAGAGTAAAAAAAAAAAAAAAAAAA

AT07283.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
Fancl-RA 1337 Fancl-RA 110..1336 1..1227 6135 100 Plus
Fancl.a 2366 Fancl.a 1132..2358 1..1227 6135 100 Plus
Fancl.b 1243 Fancl.b 20..1243 1..1227 6065 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5877412..5878409 1147..150 4990 100 Minus
chr3R 27901430 chr3R 5878464..5878615 152..1 760 100 Minus
chr3R 27901430 chr3R 5877277..5877355 1225..1147 395 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:41:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10051643..10052640 1147..150 4990 100 Minus
3R 32079331 3R 10052695..10052846 152..1 760 100 Minus
3R 32079331 3R 10051506..10051586 1227..1147 405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9792474..9793471 1147..150 4990 100 Minus
3R 31820162 3R 9793526..9793677 152..1 760 100 Minus
3R 31820162 3R 9792337..9792417 1227..1147 405 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:39:33 has no hits.

AT07283.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:40:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5877277..5877354 1148..1225 100 <- Minus
chr3R 5877412..5878407 152..1147 100 <- Minus
chr3R 5878465..5878615 1..151 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:54:42 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1146 41..1186 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:57:48 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1146 41..1186 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:42:38 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1146 41..1186 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:22:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1146 41..1186 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1146 41..1186 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:22:31 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1225 1..1225 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:57:48 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 18..1242 1..1225 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:42:38 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 24..1248 1..1225 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:22:33 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 1..1225 1..1225 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
Fancl-RA 24..1248 1..1225 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10051508..10051585 1148..1225 100 <- Minus
3R 10051643..10052638 152..1147 100 <- Minus
3R 10052696..10052846 1..151 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10051508..10051585 1148..1225 100 <- Minus
3R 10051643..10052638 152..1147 100 <- Minus
3R 10052696..10052846 1..151 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:32 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10051508..10051585 1148..1225 100 <- Minus
3R 10051643..10052638 152..1147 100 <- Minus
3R 10052696..10052846 1..151 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:42:38 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5877230..5877307 1148..1225 100 <- Minus
arm_3R 5877365..5878360 152..1147 100 <- Minus
arm_3R 5878418..5878568 1..151 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:57:31 Download gff for AT07283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9792474..9793469 152..1147 100 <- Minus
3R 9793527..9793677 1..151 100   Minus
3R 9792339..9792416 1148..1225 100 <- Minus

AT07283.hyp Sequence

Translation from 40 to 1185

> AT07283.hyp
MESNEDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHH
PALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPT
VPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLEL
KIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNF
MDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKI
IGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPK
LDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTL
MDGKTFLEVSFGQCPFCKAKLSTSFAALLND*

AT07283.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
Fancl-PA 381 CG12812-PA 1..381 1..381 2043 100 Plus
Fancl-PB 380 CG12812-PB 1..380 1..381 2026 99.7 Plus

AT07283.pep Sequence

Translation from 40 to 1185

> AT07283.pep
MESNEDVERLLCQKYPGLAAELQPSGACIIRGVLGSEDTWRRLKLYLPHH
PALHGFQLYVQESLEYKLYTSANLKLQDDWLLEDFLDHLPKILPAQKAPT
VPKELCREGNIYYDILALYKSNEYCLQVDEACSMIRFSEFTDFEQHYLEL
KIPSLLLLDHSLPDCVSLGEMLTKSAGNLEEALNLFRKLLEDLRPFYDNF
MDIDELCHVLQPSPISSKHKTRLFPLKDRVYLKLTIADPFACIASMSLKI
IGPTEEVARLRHVLSDGLSNWDSEMNIHKNLLRMFDLCYFPMPDWSDGPK
LDEEDNEELRCNICFAYRLDGGEVPLVSCDNAKCVLKCHAVCLEEWFKTL
MDGKTFLEVSFGQCPFCKAKLSTSFAALLND*

AT07283.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17137-PA 387 GF17137-PA 7..387 3..381 1420 68.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17306-PA 382 GG17306-PA 6..382 5..381 1784 93.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17888-PA 413 GH17888-PA 47..413 11..381 1187 61 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Fancl-PA 381 CG12812-PA 1..381 1..381 2043 100 Plus
Fancl-PB 380 CG12812-PB 1..380 1..381 2026 99.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24447-PA 376 GI24447-PA 5..376 6..381 1158 58.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27281-PA 381 GL27281-PA 5..379 4..380 1424 71.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11825-PA 381 GA11825-PA 5..379 4..380 1430 71.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26190-PA 382 GM26190-PA 2..382 1..381 1953 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20739-PA 381 GD20739-PA 1..381 1..381 1918 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10724-PA 379 GJ10724-PA 7..379 6..381 1192 59.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11033-PA 387 GK11033-PA 4..387 3..381 1240 62 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24708-PA 382 GE24708-PA 6..382 5..381 1760 92 Plus