Clone AT07420 Report

Search the DGRC for AT07420

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:74
Well:20
Vector:pOTB7
Associated Gene/TranscriptCG14480-RA
Protein status:AT07420.pep: gold AT07420.pep2: Inserted from web
Preliminary Size:1250
Sequenced Size:1395

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14480 2002-01-01 Sim4 clustering to Release 2
CG14480 2002-04-26 Blastp of sequenced clone
CG14480 2003-01-01 Sim4 clustering to Release 3
CG14480 2008-04-29 Release 5.5 accounting
CG14480 2008-08-15 Release 5.9 accounting
CG14480 2008-12-18 5.12 accounting

Clone Sequence Records

AT07420.complete Sequence

1395 bp (1395 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113216

> AT07420.complete
CCTCGTGCCGAATCGGCACGAGGTTCATGTGAAGGGTATTTGTTTCGATT
TACCTGAGGAAGAATTTTCAAAATTTCAGAATGTTCCGGATGAGTGTCTC
GCCTTTACCATGGACAATGCGACCAAGCAAGTTCCCATCCGCTAATCCCT
ACTTTATTTTCTTTGACCACTTTCGGATTAATCTTCAAAAGCGGGACATT
TGCCATCTGAAACCGATTTCCTTGGCCAAAATAGCCGGCAGAAAATGGCG
AGAAATGACAACCGCCCAAAAATCAGTTTTTGTGCAGATAGCCGAAATAA
ATCGAGCCAGGCTTAGGGCCCGTGGTCGCCCCAGTGTTCCAGTTGTGGGA
CTTGGAAAGTTTTTCAACGTTTAACTTAAAATGACACAGAAGCATTAGCA
ATTCCCGCCACTAGTTCAAATTTTCACGAGCCACTACCAACACTTCTATA
TCATCGCACAGCTGCTAATTCGACGTTCACCACACTGGCAATAGTTGTGG
TCTGTAAAAAAGAGCAATTTTACGAAAGTACAGCATGAGTTCGGGCTTTG
TGACTGAAGCTGAGGCGACCGAGCAAAGGCAGAGACGTCAGGAGGAATGG
GAGCGTGTACGCCAGCCGGAGGATCCACTAGAACGACCTGAGGAACCCTA
CGATGGGCGCTCACTTTATGAACGCCTCAAACAAAATAAGGACAAGAAGG
ACATGGAGTTCGAGGAAGCCCACAAGCTGAAAAACCTCATCCGTGGTCTG
GACGATGATGAGGTGCAGTTTCTGGAATTGGTCGATGCCCATAAAATACA
CGCGGAGCGCCAGCAAATGCGCGACGAGGAGCTAGAACTAAAGGATTTTC
GCAATCGTGTGGAAAAGCTGCAGGAGGAGAGTGTAGACAAGAAACTGCAA
GCTGAACTAAAAACCACAGCGAAGTCCGCGGGAGCTTCGGTCGGGCGTAG
CACTCAGAAGACGCTGCTCGGCCAGGGCATCAAGAGAAAAAACGGCGAAC
TGCCCACCACCAGTAAAGTAGCCAAAATCACTGAGAATGAGGTCGAACAG
ACAGCGACAAATGAAGCAACCAAGGACCCTGCTGATAAGACAACGAACAC
CACATTAATTACAAACAAATACAACCAGGGGGCCCTAAAGTGCATCGCTA
TACTTCCGGGCATCGGCTCCTACACGGAGTCTAGTGACTCGGAGGCCAGC
ACCGATGAGGAGGAACCCAGTATGTGCAGCCGAACCGACTTATGTGGCCG
CAAAATTCCCAAGAAGAAGCAGTGCTCAGAGTAGGATCAACTTTTTATTT
GGATTCTTAAAGTGTAGTTTTTCCTTGCAAGAAAATATAGCCTAGAGTGT
AAACGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT07420.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14480-RA 1765 CG14480-RA 5..1339 24..1358 6675 100 Plus
CG14480.a 1770 CG14480.a 5..1344 24..1358 6600 99.6 Plus
ns2-RA 2579 ns2-RA 2162..2579 1358..941 2090 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13452445..13452911 890..1356 2305 99.6 Plus
chr2R 21145070 chr2R 13451778..13452162 346..730 1895 99.5 Plus
chr2R 21145070 chr2R 13451403..13451724 24..345 1565 99.1 Plus
chr2R 21145070 chr2R 13452223..13452383 731..891 805 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:42:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17565386..17565854 890..1358 2345 100 Plus
2R 25286936 2R 17564718..17565103 345..730 1930 100 Plus
2R 25286936 2R 17564344..17564665 24..345 1610 100 Plus
2R 25286936 2R 17565164..17565324 731..891 805 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17566585..17567053 890..1358 2345 100 Plus
2R 25260384 2R 17565917..17566302 345..730 1930 100 Plus
2R 25260384 2R 17565543..17565864 24..345 1610 100 Plus
2R 25260384 2R 17566363..17566523 731..891 805 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:14:58 has no hits.

AT07420.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:15:48 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13452223..13452383 731..891 100 -> Plus
chr2R 13451399..13451724 20..345 98 -> Plus
chr2R 13451778..13452162 346..730 99 -> Plus
chr2R 13452447..13452911 892..1356 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:54:49 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..750 535..1284 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:04 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RB 1..750 535..1284 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:09:05 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..750 535..1284 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:24 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..750 535..1284 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:56 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..750 535..1284 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:48 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..1337 20..1356 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:04 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..1337 20..1356 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:09:05 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..1337 20..1356 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:25 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..1337 20..1356 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:56 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
CG14480-RA 1..1337 20..1356 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:48 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17565164..17565324 731..891 100 -> Plus
2R 17564340..17564665 20..345 99 -> Plus
2R 17564719..17565103 346..730 100 -> Plus
2R 17565388..17565852 892..1356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:48 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17565164..17565324 731..891 100 -> Plus
2R 17564340..17564665 20..345 99 -> Plus
2R 17564719..17565103 346..730 100 -> Plus
2R 17565388..17565852 892..1356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:15:48 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17565164..17565324 731..891 100 -> Plus
2R 17564340..17564665 20..345 99 -> Plus
2R 17564719..17565103 346..730 100 -> Plus
2R 17565388..17565852 892..1356 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:09:05 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13452669..13452829 731..891 100 -> Plus
arm_2R 13451845..13452170 20..345 99 -> Plus
arm_2R 13452224..13452608 346..730 100 -> Plus
arm_2R 13452893..13453357 892..1356 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:18 Download gff for AT07420.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17565539..17565864 20..345 99 -> Plus
2R 17565918..17566302 346..730 100 -> Plus
2R 17566363..17566523 731..891 100 -> Plus
2R 17566587..17567051 892..1356 100   Plus

AT07420.pep2 Sequence

Translation from 80 to 373

> AT07420.pep2
MFRMSVSPLPWTMRPSKFPSANPYFIFFDHFRINLQKRDICHLKPISLAK
IAGRKWREMTTAQKSVFVQIAEINRARLRARGRPSVPVVGLGKFFNV*
Sequence AT07420.pep2 has no blast hits.

AT07420.pep Sequence

Translation from 534 to 1283

> AT07420.pep
MSSGFVTEAEATEQRQRRQEEWERVRQPEDPLERPEEPYDGRSLYERLKQ
NKDKKDMEFEEAHKLKNLIRGLDDDEVQFLELVDAHKIHAERQQMRDEEL
ELKDFRNRVEKLQEESVDKKLQAELKTTAKSAGASVGRSTQKTLLGQGIK
RKNGELPTTSKVAKITENEVEQTATNEATKDPADKTTNTTLITNKYNQGA
LKCIAILPGIGSYTESSDSEASTDEEEPSMCSRTDLCGRKIPKKKQCSE*

AT07420.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11643-PA 237 GF11643-PA 1..237 1..249 1034 82 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21799-PA 243 GG21799-PA 1..243 1..249 1162 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20924-PA 241 GH20924-PA 1..241 1..249 860 74.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14480-PB 249 CG14480-PB 1..249 1..249 1273 100 Plus
CG14480-PA 249 CG14480-PA 1..249 1..249 1273 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18362-PA 243 GI18362-PA 1..243 1..249 890 72.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11467-PA 237 GL11467-PA 1..237 1..249 914 73.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13016-PA 235 GA13016-PA 1..235 1..249 924 75.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21802-PA 249 GM21802-PA 1..249 1..249 1287 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11291-PA 249 GD11291-PA 1..249 1..249 1298 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21431-PA 243 GJ21431-PA 1..243 1..249 936 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21902-PA 243 GK21902-PA 1..241 1..247 958 76.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11874-PA 249 GE11874-PA 1..249 1..249 1202 94.4 Plus

AT07420.hyp Sequence

Translation from 534 to 1283

> AT07420.hyp
MSSGFVTEAEATEQRQRRQEEWERVRQPEDPLERPEEPYDGRSLYERLKQ
NKDKKDMEFEEAHKLKNLIRGLDDDEVQFLELVDAHKIHAERQQMRDEEL
ELKDFRNRVEKLQEESVDKKLQAELKTTAKSAGASVGRSTQKTLLGQGIK
RKNGELPTTSKVAKITENEVEQTATNEATKDPADKTTNTTLITNKYNQGA
LKCIAILPGIGSYTESSDSEASTDEEEPSMCSRTDLCGRKIPKKKQCSE*

AT07420.hyp Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2023-01-03 19:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14480-PB 249 CG14480-PB 1..249 1..249 1273 100 Plus
CG14480-PA 249 CG14480-PA 1..249 1..249 1273 100 Plus