Clone AT07608 Report

Search the DGRC for AT07608

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:76
Well:8
Vector:pOTB7
Associated Gene/TranscriptCG13539-RA
Protein status:AT07608.pep: gold
Preliminary Size:783
Sequenced Size:871

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13539 2002-01-01 Sim4 clustering to Release 2
CG13539 2002-02-22 Blastp of sequenced clone
CG13539 2003-01-01 Sim4 clustering to Release 3
CG13539 2008-04-29 Release 5.5 accounting
CG13539 2008-08-15 Release 5.9 accounting
CG13539 2008-12-18 5.12 accounting

Clone Sequence Records

AT07608.complete Sequence

871 bp (871 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089274

> AT07608.complete
CTAAATTCCAAGTGAGAGGATATAAAATGACCGACCATTCAGCCCATCCA
AACGAGGAGGAGGTGATCGGGGACATCTACTTGTCCCTACTCTCGCGACA
TGCCCACAGATATCCGGAGGATGGAAGCCACAAGTCGTGGATCCTTCCGC
GCATGATGGTTCTGTTCGCCAGTGGGGATATGGATCAGGTTATAGAGGCC
ATAGTCTCGGACATGATCCATCCGATTGGAACTGGACTGGTGGCCAGTGT
TCTGGTCGAGGAGTCCATACGGGACGAGATGATTAAGAGAATACGAGCCA
ACTTGAAGCCGATGAGCGAGCGCATCCAACACCATCCCAATTACCTGAAG
ACAGTGAAGCTCATCGATCGAATGAACTGCTCCACCATTCACATCGAGGA
GTTCGAGGAGTCGGATACGAAGAAGCGTTATGGTCGCCGGATGAAGGGAT
CCCCTTTGATAGTCTTGGATTTCCCCCAATTCTATTTCGGTGGCAAGCCC
ACGGCCATAATGACTATGAGCACCTTTCGCAATATGAATGAAGTGGTTAA
GTTGCATTCGCGCGAAGGTCTGAATTTCGACTGTATTACCGTGTGGTCAG
CCAAGTTGGCCCAGTGCTTCGACCTGCTCACCAGAGTGCCCACGGTGGAC
CAGTGGACCTTCAACTGCACCAAGGAATCCATCAAGGTTCCAAAACTGCC
AGCTCAACCGACCACCACAGTTATAATCGTTAAGAACATTCACTATGAAG
TCCACGTCATTGGCGGAAAGATCAAAACTATAGCGTTTCCAATCGTAGAT
ACTTCTTGAGCTGAGCTGAGCTTTTATAAATGTATTCCACGGCAATAAGA
CACAAAAAAAAAAAAAAAAAA

AT07608.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13539-RA 881 CG13539-RA 34..881 1..853 4105 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19070894..19071741 1..853 4050 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:42:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23184441..23185288 1..853 4095 98.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23185640..23186456 1..817 4040 99.6 Plus
2R 25260384 2R 23186446..23186487 812..853 195 97.6 Plus
Blast to na_te.dros performed on 2019-03-16 15:47:25 has no hits.

AT07608.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:48:42 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19070894..19071741 1..853 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:55:13 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 1..783 27..809 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:33 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 1..783 27..809 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:54:01 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 1..783 27..809 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:05 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 1..783 27..809 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:53:53 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 1..783 27..809 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:27 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 34..881 1..853 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:32 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 34..881 1..853 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:54:01 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 34..881 1..853 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:05 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 34..881 1..853 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:53:53 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
CG13539-RA 34..881 1..853 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:42 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23184441..23185288 1..853 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:42 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23184441..23185288 1..853 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:48:42 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23184441..23185288 1..853 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:54:01 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19071964..19072811 1..853 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:49 Download gff for AT07608.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23185658..23186505 1..853 98   Plus

AT07608.hyp Sequence

Translation from 2 to 808

> AT07608.hyp
KFQVRGYKMTDHSAHPNEEEVIGDIYLSLLSRHAHRYPEDGSHKSWILPR
MMVLFASGDMDQVIEAIVSDMIHPIGTGLVASVLVEESIRDEMIKRIRAN
LKPMSERIQHHPNYLKTVKLIDRMNCSTIHIEEFEESDTKKRYGRRMKGS
PLIVLDFPQFYFGGKPTAIMTMSTFRNMNEVVKLHSREGLNFDCITVWSA
KLAQCFDLLTRVPTVDQWTFNCTKESIKVPKLPAQPTTTVIIVKNIHYEV
HVIGGKIKTIAFPIVDTS*

AT07608.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13539-PB 260 CG13539-PB 1..260 9..268 1363 100 Plus
CG13539-PA 260 CG13539-PA 1..260 9..268 1363 100 Plus
CG15717-PE 252 CG15717-PE 35..246 42..264 301 28.1 Plus
CG15717-PC 252 CG15717-PC 35..246 42..264 301 28.1 Plus
CG15717-PA 252 CG15717-PA 35..246 42..264 301 28.1 Plus

AT07608.pep Sequence

Translation from 26 to 808

> AT07608.pep
MTDHSAHPNEEEVIGDIYLSLLSRHAHRYPEDGSHKSWILPRMMVLFASG
DMDQVIEAIVSDMIHPIGTGLVASVLVEESIRDEMIKRIRANLKPMSERI
QHHPNYLKTVKLIDRMNCSTIHIEEFEESDTKKRYGRRMKGSPLIVLDFP
QFYFGGKPTAIMTMSTFRNMNEVVKLHSREGLNFDCITVWSAKLAQCFDL
LTRVPTVDQWTFNCTKESIKVPKLPAQPTTTVIIVKNIHYEVHVIGGKIK
TIAFPIVDTS*

AT07608.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19861-PA 253 GF19861-PA 8..252 12..256 868 61.2 Plus
Dana\GF21319-PA 253 GF21319-PA 42..247 41..256 305 28.9 Plus
Dana\GF21434-PA 276 GF21434-PA 14..240 29..257 271 30.6 Plus
Dana\GF18368-PA 320 GF18368-PA 98..307 38..256 224 25.6 Plus
Dana\GF16130-PA 294 GF16130-PA 77..287 38..255 224 25.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22833-PA 259 GG22833-PA 1..259 1..260 1200 83.5 Plus
Dere\GG17756-PA 256 GG17756-PA 43..250 38..256 312 27.7 Plus
Dere\GG13512-PA 316 GG13512-PA 84..301 30..256 293 29.4 Plus
Dere\GG21350-PA 296 GG21350-PA 63..270 41..256 272 29.4 Plus
Dere\GG12073-PA 291 GG12073-PA 73..285 37..256 256 26.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24176-PA 272 GH24176-PA 27..272 8..260 666 48.2 Plus
Dgri\GH12022-PA 253 GH12022-PA 13..237 29..255 317 30.9 Plus
Dgri\GH17535-PA 306 GH17535-PA 71..282 33..256 268 27.2 Plus
Dgri\GH10452-PA 306 GH10452-PA 79..282 41..256 268 28.2 Plus
Dgri\GH12691-PA 274 GH12691-PA 58..268 38..256 215 22.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13539-PB 260 CG13539-PB 1..260 1..260 1363 100 Plus
CG13539-PA 260 CG13539-PA 1..260 1..260 1363 100 Plus
CG15717-PE 252 CG15717-PE 35..246 34..256 301 28.1 Plus
CG15717-PC 252 CG15717-PC 35..246 34..256 301 28.1 Plus
CG15717-PA 252 CG15717-PA 35..246 34..256 301 28.1 Plus
CG2336-PA 322 CG2336-PA 90..307 30..256 287 29.8 Plus
CG11634-PB 298 CG11634-PB 68..275 41..256 275 29 Plus
CG11634-PA 298 CG11634-PA 68..275 41..256 275 29 Plus
CG12637-PA 292 CG12637-PA 14..240 29..257 254 26 Plus
CG12516-PB 300 CG12516-PB 82..294 37..256 254 27 Plus
CG5623-PA 279 CG5623-PA 34..247 36..255 164 22.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15524-PA 271 GI15524-PA 26..266 8..256 616 44.2 Plus
Dmoj\GI14293-PA 252 GI14293-PA 13..237 29..255 287 28.6 Plus
Dmoj\GI17704-PA 335 GI17704-PA 105..311 42..256 276 29.2 Plus
Dmoj\GI16366-PA 282 GI16366-PA 67..276 38..256 236 27.6 Plus
Dmoj\GI22587-PA 272 GI22587-PA 34..245 36..255 227 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21165-PA 280 GL21165-PA 34..274 16..256 867 63.5 Plus
Dper\GL14951-PA 265 GL14951-PA 41..259 31..256 307 29.4 Plus
Dper\GL21758-PA 320 GL21758-PA 80..295 30..255 282 28.2 Plus
Dper\GL23868-PA 301 GL23868-PA 85..295 37..256 274 27.3 Plus
Dper\GL14981-PA 272 GL14981-PA 13..238 29..255 270 24.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:08:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28745-PA 280 GA28745-PA 34..274 16..256 868 63.5 Plus
Dpse\GA13910-PA 265 GA13910-PA 41..259 31..256 310 30.6 Plus
Dpse\GA22393-PA 2068 GA22393-PA 703..931 29..258 278 26.3 Plus
Dpse\GA26390-PA 320 GA26390-PA 80..295 30..255 277 27.8 Plus
Dpse\GA11672-PA 301 GA11672-PA 85..295 37..256 276 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15991-PA 261 GM15991-PA 1..261 1..260 1317 94.3 Plus
Dsec\GM11602-PA 252 GM11602-PA 35..246 34..256 293 28.4 Plus
Dsec\GM10901-PA 319 GM10901-PA 95..304 38..256 291 29.9 Plus
Dsec\GM16149-PA 298 GM16149-PA 62..276 35..257 279 29.5 Plus
Dsec\GM11293-PA 292 GM11293-PA 14..240 29..257 256 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11744-PA 261 GD11744-PA 1..261 1..260 1324 94.6 Plus
Dsim\GD19880-PA 321 GD19880-PA 89..306 30..256 307 31 Plus
Dsim\GD17100-PA 252 GD17100-PA 35..246 34..256 304 28.9 Plus
Dsim\GD24338-PA 298 GD24338-PA 62..276 35..257 279 29.5 Plus
Dsim\GD16020-PA 292 GD16020-PA 14..240 29..257 259 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14727-PA 272 GJ14727-PA 27..268 8..256 718 51.4 Plus
Dvir\GJ19350-PA 246 GJ19350-PA 13..237 29..255 318 32.9 Plus
Dvir\GJ11430-PA 333 GJ11430-PA 102..309 41..256 271 26.6 Plus
Dvir\GJ16736-PA 280 GJ16736-PA 65..274 38..256 255 25 Plus
Dvir\GJ13210-PA 254 GJ13210-PA 39..234 38..242 237 25.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17389-PA 299 GK17389-PA 77..293 32..256 301 29 Plus
Dwil\GK24553-PA 296 GK24553-PA 84..290 37..256 284 27.1 Plus
Dwil\GK11577-PA 271 GK11577-PA 53..264 38..256 257 26.9 Plus
Dwil\GK20103-PA 266 GK20103-PA 13..237 29..255 256 27.1 Plus
Dwil\GK18716-PA 274 GK18716-PA 39..250 41..256 231 25.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14269-PA 266 GE14269-PA 1..260 1..260 1242 86.2 Plus
Dyak\GE17046-PA 253 GE17046-PA 36..247 34..256 317 28.1 Plus
Dyak\GE10227-PA 323 GE10227-PA 93..310 30..256 296 29.7 Plus
Dyak\GE15381-PA 269 GE15381-PA 14..240 29..257 289 27.7 Plus
Dyak\GE12931-PA 297 GE12931-PA 67..274 41..256 270 29.4 Plus