Clone AT07685 Report

Search the DGRC for AT07685

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:76
Well:85
Vector:pOTB7
Associated Gene/TranscriptCG10396-RA
Protein status:AT07685.pep: gold
Preliminary Size:489
Sequenced Size:689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10396 2002-01-01 Sim4 clustering to Release 2
CG10396 2002-02-22 Blastp of sequenced clone
CG10396 2003-01-01 Sim4 clustering to Release 3
CG10396 2008-04-29 Release 5.5 accounting
CG10396 2008-08-15 Release 5.9 accounting
CG10396 2008-12-18 5.12 accounting

Clone Sequence Records

AT07685.complete Sequence

689 bp (689 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084105

> AT07685.complete
AGCAACACAACTGTCGAATTTCCGGATGAAGTAAAAAAACAAAAAATTGA
AAAGTACACTGCCGTCGAAATGAGCTTATTTCCCTGTATGAAATTGAGGA
AACTTTTCCAGATGACGAGGCGTCGGTTTGCCAGTGGAGGAGATGGTATT
CGACTTATGGTCGCCGATCGCCAGGTCGTTGGTCATGGAATCAATGGGCG
ACCCATATACTTCGATAGTCCGGACTGCCCTTTTCCGGCTATTCGATATC
GGGAGGTTAGCCCAGAGTTGTGTGCCCTACGTGAAAAGGAGTTGGACGAC
TGGAAGAAGCTGTCGCTGGATGAAAAGAAGCAATTATACCGATATAGCTT
CTGCCAAACATATGCAGAATTCCAGCACATTACACCCGAATGGAAGATGT
GTCTGGGCGTCGCTTTGTGGCTTGTGTCAATCGGAATCGCGATATCGATA
ACTATGAAGACCGTTCTCTATGGAAAACTGCCGGATACGTTTAACGATGA
GCGCCAGTCGGCCCAATTGCGGCGCATCATCCAGCTGCAAATGAACCCAA
TTACTGGACTAGCGTCCAAATGGTGCTACCGAGAGAACAAGTGGAAGTAG
CACATCAACACGATGATTTTCCGTAAACTATGTACAGAAACGTAACTAGC
AAAATACAATTCAACAGCAAAAAAAAAAAAAAAAAAAAA

AT07685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG10396-RA 1106 CG10396-RA 66..735 1..671 3300 99.7 Plus
CG10396.b 688 CG10396.b 114..688 97..671 2860 99.8 Plus
CG10396.a 869 CG10396.a 178..740 109..671 2800 99.8 Plus
CG10396.b 688 CG10396.b 1..53 1..54 230 98.1 Plus
CG10396.a 869 CG10396.a 66..118 1..54 230 98.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1241528..1242142 54..668 3075 100 Plus
chr2R 21145070 chr2R 1241413..1241465 1..54 220 98.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:42:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5354109..5354726 54..671 3075 99.8 Plus
2R 25286936 2R 5353994..5354046 1..54 220 98.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5355308..5355925 54..671 3075 99.8 Plus
2R 25260384 2R 5355193..5355245 1..54 230 98.1 Plus
Blast to na_te.dros performed on 2019-03-16 00:12:01 has no hits.

AT07685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:13:10 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1241413..1241464 1..53 98 -> Plus
chr2R 1241528..1242142 54..668 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:55:15 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:04 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:29 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:05 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:00:56 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..531 70..600 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:26 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..667 1..668 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:04 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..667 1..668 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:29 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..667 1..668 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:05 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..667 1..668 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:00:56 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
CG10396-RA 1..667 1..668 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:10 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5353994..5354045 1..53 98 -> Plus
2R 5354109..5354723 54..668 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:10 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5353994..5354045 1..53 98 -> Plus
2R 5354109..5354723 54..668 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:13:10 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5353994..5354045 1..53 98 -> Plus
2R 5354109..5354723 54..668 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:29 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1241499..1241550 1..53 98 -> Plus
arm_2R 1241614..1242228 54..668 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:43 Download gff for AT07685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5355308..5355922 54..668 99   Plus
2R 5355193..5355244 1..53 98 -> Plus

AT07685.hyp Sequence

Translation from 69 to 599

> AT07685.hyp
MSLFPCMKLRKLFQMTRRRFASGGDGIRLMVADRQVVGHGINGRPIYFDS
PDCPFPAIRYREVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAE
FQHITPEWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQL
RRIIQLQMNPITGLASKWCYRENKWK*

AT07685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG10396-PA 176 CG10396-PA 1..176 1..176 947 100 Plus
CG10396-PB 162 CG10396-PB 1..162 15..176 873 100 Plus
CoIV-PD 182 CG10664-PD 36..181 31..176 391 51.4 Plus
CoIV-PC 182 CG10664-PC 36..181 31..176 391 51.4 Plus
CoIV-PB 182 CG10664-PB 36..181 31..176 391 51.4 Plus

AT07685.pep Sequence

Translation from 69 to 599

> AT07685.pep
MSLFPCMKLRKLFQMTRRRFASGGDGIRLMVADRQVVGHGINGRPIYFDS
PDCPFPAIRYREVSPELCALREKELDDWKKLSLDEKKQLYRYSFCQTYAE
FQHITPEWKMCLGVALWLVSIGIAISITMKTVLYGKLPDTFNDERQSAQL
RRIIQLQMNPITGLASKWCYRENKWK*

AT07685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19202-PA 180 GF19202-PA 24..180 19..176 612 70.3 Plus
Dana\GF14440-PA 182 GF14440-PA 36..181 31..176 413 53.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14869-PA 176 GG14869-PA 1..176 1..176 831 85.2 Plus
Dere\GG21213-PA 182 GG21213-PA 36..181 31..176 402 52.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24897-PA 183 GH24897-PA 26..183 18..176 493 59.7 Plus
Dgri\GH13835-PA 182 GH13835-PA 36..181 31..176 394 50.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
COX4L-PA 176 CG10396-PA 1..176 1..176 947 100 Plus
COX4L-PB 162 CG10396-PB 1..162 15..176 873 100 Plus
COX4-PD 182 CG10664-PD 36..181 31..176 391 51.4 Plus
COX4-PC 182 CG10664-PC 36..181 31..176 391 51.4 Plus
COX4-PB 182 CG10664-PB 36..181 31..176 391 51.4 Plus
COX4-PA 182 CG10664-PA 36..181 31..176 391 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15072-PA 198 GI15072-PA 41..198 18..176 564 63.5 Plus
Dmoj\GI20302-PA 182 GI20302-PA 36..181 31..176 409 53.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12448-PA 187 GL12448-PA 26..187 15..176 578 63 Plus
Dper\GL22539-PA 180 GL22539-PA 26..180 15..169 531 60 Plus
Dper\GL26331-PA 182 GL26331-PA 36..181 31..176 398 54.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27506-PA 187 GA27506-PA 26..187 15..176 568 61.7 Plus
Dpse\GA27921-PA 185 GA27921-PA 30..185 12..169 523 58.9 Plus
Dpse\GA10478-PA 182 GA10478-PA 36..181 31..176 398 54.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11103-PA 176 GM11103-PA 1..176 1..176 903 93.8 Plus
Dsec\GM17383-PA 182 GM17383-PA 36..181 31..176 401 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10371-PA 176 GD10371-PA 1..176 1..176 899 94.3 Plus
Dsim\CoIV-PA 182 GD24236-PA 36..181 31..176 401 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18878-PA 191 GJ18878-PA 41..191 25..176 555 63.8 Plus
Dvir\GJ13654-PA 182 GJ13654-PA 36..181 31..176 407 53.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19830-PA 189 GK19830-PA 38..189 25..176 580 65.8 Plus
Dwil\GK14931-PA 182 GK14931-PA 36..181 31..176 416 54.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15061-PA 176 GE15061-PA 1..176 1..176 862 88.1 Plus
Dyak\GE14691-PA 202 GE14691-PA 1..156 15..174 753 86.2 Plus
Dyak\GE13288-PA 182 GE13288-PA 36..181 31..176 402 52.1 Plus