Clone AT07769 Report

Search the DGRC for AT07769

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:77
Well:69
Vector:pOTB7
Associated Gene/TranscriptCG7542-RA
Protein status:AT07769.pep: gold
Preliminary Size:813
Sequenced Size:916

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7542 2002-01-01 Sim4 clustering to Release 2
CG7542 2002-02-22 Blastp of sequenced clone
CG7542 2003-01-01 Sim4 clustering to Release 3
CG7542 2008-04-29 Release 5.5 accounting
CG7542 2008-08-15 Release 5.9 accounting
CG7542 2008-12-18 5.12 accounting

Clone Sequence Records

AT07769.complete Sequence

916 bp (916 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089278

> AT07769.complete
CTTCACTCAAAACAACCGATTTTGTGCCTAGAAACCTAGAACCTAGAAAA
TGATGAAACTTTTGGTTTGCGTCCTGCTGGTAGGATCCTGTACGGCTGTT
CCCCTCCTTACCGATGTGGAACCCTATATTACGAATGGAGAACCGGCGGA
GGTGGGTCAGTTTCCCTACCAGGCCGGTCTGAACGTCTCCTTCGGGAACT
GGAGCACTTGGTGCGGCGGCACCTTGATCTCACACTACTGGATAATCACA
GCAGCACACTGCATGGATGGGGCGGAGTCCGTAACGGTCTATTTGGGGGC
CATAAACATCGGTGATGAGTCCGAGGAGGGTCAGGAAAGGATCATGGTGG
AGAAGTCGGGTATTATAGTGCACTCGAACTATATGGCCAGCACGGTGGTC
AATGACATCTCGCTTATTCGATTGCCCGCCTTTGTGGGTTTCACTGATCG
CATCCGGGCCGCCAGTTTGCCCCGTCGCTTGAATGGCCAGTTTCCCACGT
ACGAGTCCATCCGGGCCTTCGCCTCCGGCTGGGGGCGGGAAAGCGATGCC
TCCGACTCGGTTTCCCCCGTGCTGAGATACGTGGAGATGCCCATTATGCC
TCACTCCCTGTGCCGGATGTACTGGAGTGGAGCTGTGTCGGAGAAGATGA
TCTGCATGAGCACCACCAGCGGCAAGTCCACCTGCCATGGTGACTCTGGC
GGTCCGCTGGTCTACAAGCAGGGCAACTCCAGCTACCTGATCGGATCCAC
CTCTTTTGGAACCTCTATGGGATGTCAAGTGGGATTCCCGGCCGTGTTCA
CCCGCATCAGCAGCTACTTGGACTGGATCCTTAACCATATCATCGCCCAT
AATAAAGAATAAGCTAAGACTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA

AT07769.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG7542-RA 833 CG7542-RA 1..833 39..871 4135 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 17539335..17540167 39..871 4150 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:42:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17549826..17550661 39..874 4150 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 17542926..17543761 39..874 4150 99.7 Plus
Blast to na_te.dros performed 2019-03-16 00:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
F-element 4708 F-element F 4708bp 38..80 43..1 143 81.4 Minus
Doc2-element 4789 Doc2-element DOC2 4789bp 42..72 31..1 110 83.9 Minus

AT07769.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:20:51 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 17539338..17540167 42..871 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:55:32 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..813 50..862 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:42:50 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..813 50..862 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:56:04 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..813 50..862 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:11:30 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..813 50..862 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:57:21 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..813 50..862 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:07:31 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..833 39..871 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:42:50 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..833 39..871 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:56:04 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..833 39..871 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:11:31 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..833 39..871 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:57:21 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
CG7542-RA 1..833 39..871 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:51 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17549829..17550658 42..871 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:51 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17549829..17550658 42..871 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:20:51 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17549829..17550658 42..871 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:56:04 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17542929..17543758 42..871 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:58 Download gff for AT07769.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17542929..17543758 42..871 99   Plus

AT07769.pep Sequence

Translation from 49 to 861

> AT07769.pep
MMKLLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGN
WSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMV
EKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPT
YESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKM
ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVF
TRISSYLDWILNHIIAHNKE*

AT07769.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10540-PA 276 GF10540-PA 1..271 2..269 1130 76.5 Plus
Dana\GF23751-PA 292 GF23751-PA 49..281 27..260 581 49.8 Plus
Dana\GF10666-PA 268 GF10666-PA 1..262 2..260 560 44.8 Plus
Dana\GF23904-PA 346 GF23904-PA 1..241 1..252 502 41.7 Plus
Dana\GF10671-PA 452 GF10671-PA 112..370 10..260 474 38.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13625-PA 270 GG13625-PA 1..270 1..270 1368 93.3 Plus
Dere\GG14091-PA 290 GG14091-PA 47..279 27..260 571 50.2 Plus
Dere\GG15803-PA 260 GG15803-PA 1..257 2..263 558 43 Plus
Dere\GG15307-PA 270 GG15307-PA 1..270 2..266 523 44.1 Plus
Dere\GG14094-PA 272 GG14094-PA 1..264 2..260 497 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16120-PA 254 GH16120-PA 13..250 27..264 924 71 Plus
Dgri\GH16119-PA 263 GH16119-PA 23..254 27..260 790 61.1 Plus
Dgri\GH16446-PA 290 GH16446-PA 47..282 27..263 577 45.8 Plus
Dgri\GH15022-PA 272 GH15022-PA 1..267 2..263 561 44.6 Plus
Dgri\GH23606-PA 220 GH23606-PA 14..215 54..263 499 47.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7542-PB 270 CG7542-PB 1..270 1..270 1431 100 Plus
CG7542-PA 270 CG7542-PA 1..270 1..270 1431 100 Plus
CG10472-PA 290 CG10472-PA 47..279 27..260 585 50.2 Plus
Jon65Aiv-PA 271 CG6467-PA 28..265 17..260 545 46.3 Plus
yip7-PA 270 CG6457-PA 1..264 2..260 499 42 Plus
Jon65Aiii-PA 274 CG6483-PA 30..266 17..260 492 43.7 Plus
CG10477-PB 272 CG10477-PB 31..266 15..262 479 42.2 Plus
CG10477-PA 272 CG10477-PA 31..266 15..262 479 42.2 Plus
Jon99Cii-PA 265 CG31034-PA 1..257 2..260 468 43.1 Plus
Jon99Ciii-PB 265 CG31362-PB 1..257 2..260 468 43.1 Plus
Jon99Ciii-PA 265 CG31362-PA 1..257 2..260 468 43.1 Plus
CG6592-PA 438 CG6592-PA 123..357 27..260 458 39.8 Plus
Jon99Fi-PA 267 CG18030-PA 1..259 2..260 455 42.1 Plus
Jon99Fii-PA 267 CG2229-PA 1..259 2..260 451 41.7 Plus
Jon74E-PC 271 CG6298-PC 32..262 27..260 446 41.8 Plus
Jon25Bii-PB 276 CG8869-PB 1..271 2..263 441 41.4 Plus
Jon25Bii-PA 276 CG8869-PA 1..271 2..263 441 41.4 Plus
Jon44E-PB 271 CG8579-PB 31..266 17..263 436 40.3 Plus
Jon44E-PA 271 CG8579-PA 31..266 17..263 436 40.3 Plus
Jon99Ci-PA 272 CG31039-PA 37..264 23..260 434 41.7 Plus
Jon66Cii-PA 262 CG7170-PA 35..256 22..263 418 41.7 Plus
Jon65Ai-PB 262 CG10475-PB 1..254 2..260 415 39.9 Plus
Jon65Ai-PA 262 CG10475-PA 1..254 2..260 415 39.9 Plus
CG3088-PA 252 CG3088-PA 1..244 2..260 402 38 Plus
CG6462-PA 319 CG6462-PA 73..311 23..260 396 37.3 Plus
Jon66Ci-PA 260 CG7118-PA 33..254 23..263 390 40.1 Plus
Jon25Bi-PB 266 CG8867-PB 27..257 17..260 387 38.4 Plus
Jon25Biii-PA 258 CG8871-PA 5..253 4..263 385 38.7 Plus
CG11529-PA 287 CG11529-PA 38..264 35..269 373 35.9 Plus
Jon65Aii-PA 259 CG6580-PA 27..254 17..263 363 35.7 Plus
CG10469-PA 267 CG10469-PA 24..259 27..260 360 38.2 Plus
CG8299-PA 260 CG8299-PA 7..252 9..260 308 32.3 Plus
snk-PB 435 CG7996-PB 184..427 25..260 296 32.2 Plus
snk-PA 435 CG7996-PA 184..427 25..260 296 32.2 Plus
l(2)k05911-PC 639 CG31728-PC 393..638 20..264 294 32.7 Plus
CG8329-PA 259 CG8329-PA 35..250 27..260 289 34.2 Plus
betaTry-PB 253 CG18211-PB 1..252 1..263 288 31.1 Plus
betaTry-PA 253 CG18211-PA 1..252 1..263 288 31.1 Plus
CG31954-PA 277 CG31954-PA 51..274 27..263 287 33.7 Plus
alphaTry-PA 256 CG18444-PA 7..251 1..262 285 31.7 Plus
CG17571-PB 258 CG17571-PB 5..253 1..262 279 30.1 Plus
CG17571-PA 258 CG17571-PA 5..253 1..262 279 30.1 Plus
CG3355-PA 314 CG3355-PA 76..302 27..260 279 31.8 Plus
CG11836-PI 281 CG11836-PI 45..274 27..264 278 30.2 Plus
CG11836-PJ 333 CG11836-PJ 97..326 27..264 278 30.2 Plus
CG18179-PA 268 CG18179-PA 30..260 17..260 277 35 Plus
CG8172-PD 371 CG8172-PD 126..369 27..268 277 31.6 Plus
CG9372-PA 408 CG9372-PA 172..403 25..261 277 31.5 Plus
CG8172-PE 545 CG8172-PE 300..543 27..268 277 31.6 Plus
CG11911-PA 277 CG11911-PA 36..275 26..269 274 31.5 Plus
CG32260-PC 395 CG32260-PC 148..392 27..264 274 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12387-PA 266 GI12387-PA 1..264 1..264 888 60.2 Plus
Dmoj\GI12385-PA 264 GI12385-PA 20..264 23..269 803 61.1 Plus
Dmoj\GI16701-PA 290 GI16701-PA 47..288 27..269 604 50 Plus
Dmoj\GI12958-PA 279 GI12958-PA 36..273 17..262 568 45.9 Plus
Dmoj\GI16676-PA 273 GI16676-PA 1..265 2..260 561 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25139-PA 270 GL25139-PA 7..268 4..264 1035 73.3 Plus
Dper\GL15526-PA 289 GL15526-PA 46..278 27..260 572 48.9 Plus
Dper\GL25036-PA 263 GL25036-PA 1..258 2..263 546 42.9 Plus
Dper\GL15536-PA 274 GL15536-PA 22..266 10..260 493 42.7 Plus
Dper\GL15538-PA 272 GL15538-PA 30..267 17..263 479 44 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20426-PA 270 GA20426-PA 7..268 4..264 1036 73.3 Plus
Dpse\GA10335-PA 289 GA10335-PA 46..278 27..260 560 48.5 Plus
Dpse\GA23594-PA 263 GA23594-PA 1..258 2..263 549 43.2 Plus
Dpse\GA19618-PA 274 GA19618-PA 22..266 10..260 489 42.3 Plus
Dpse\GA19627-PA 274 GA19627-PA 30..269 17..263 486 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25710-PA 270 GM25710-PA 1..270 1..270 1402 95.9 Plus
Dsec\GM13874-PA 290 GM13874-PA 47..279 27..260 585 49.8 Plus
Dsec\GM13877-PA 272 GM13877-PA 36..267 23..263 499 43.9 Plus
Dsec\GM14740-PA 711 GM14740-PA 1..264 2..260 486 41.6 Plus
Dsec\GM14741-PA 274 GM14741-PA 30..266 17..260 483 42.9 Plus
Dsec\GM14740-PA 711 GM14740-PA 526..705 77..260 340 43.5 Plus
Dsec\GM14740-PA 711 GM14740-PA 322..544 23..244 337 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:15:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14718-PA 159 GD14718-PA 1..159 112..270 827 96.9 Plus
Dsim\GD13158-PA 290 GD13158-PA 47..279 27..260 582 49.8 Plus
Dsim\GD13922-PA 271 GD13922-PA 1..265 2..260 533 44.7 Plus
Dsim\GD13923-PA 274 GD13923-PA 30..266 17..260 502 44.1 Plus
Dsim\GD13920-PA 270 GD13920-PA 1..264 1..260 484 40.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12275-PA 264 GJ12275-PA 17..259 27..269 942 67.5 Plus
Dvir\GJ12274-PA 263 GJ12274-PA 23..263 27..269 818 61.3 Plus
Dvir\GJ12437-PA 290 GJ12437-PA 47..282 27..263 600 50.8 Plus
Dvir\GJ13101-PA 249 GJ13101-PA 8..246 17..263 555 45.7 Plus
Dvir\GJ12928-PA 274 GJ12928-PA 1..266 2..260 550 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17178-PA 270 GK17178-PA 1..266 1..264 942 70.6 Plus
Dwil\GK17275-PA 297 GK17275-PA 54..286 27..260 616 51.5 Plus
Dwil\GK17276-PA 290 GK17276-PA 46..279 24..260 596 49.6 Plus
Dwil\GK18044-PA 273 GK18044-PA 1..268 1..263 545 42 Plus
Dwil\GK16888-PA 274 GK16888-PA 21..266 10..260 496 47.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19921-PA 270 GE19921-PA 1..267 1..267 1343 92.9 Plus
Dyak\GE20514-PA 290 GE20514-PA 47..279 27..260 575 49.4 Plus
Dyak\GE21528-PA 273 GE21528-PA 1..265 2..260 560 45.4 Plus
Dyak\GE22139-PA 260 GE22139-PA 1..257 2..263 534 41.9 Plus
Dyak\GE22140-PA 260 GE22140-PA 1..257 2..263 534 41.9 Plus

AT07769.hyp Sequence

Translation from 49 to 861

> AT07769.hyp
MMKLLVCVLLVGSCTAVPLLTDVEPYITNGEPAEVGQFPYQAGLNVSFGN
WSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDESEEGQERIMV
EKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAASLPRRLNGQFPT
YESIRAFASGWGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKM
ICMSTTSGKSTCHGDSGGPLVYKQGNSSYLIGSTSFGTSMGCQVGFPAVF
TRISSYLDWILNHIIAHNKE*

AT07769.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7542-PB 270 CG7542-PB 1..270 1..270 1431 100 Plus
CG7542-PA 270 CG7542-PA 1..270 1..270 1431 100 Plus
CG10472-PA 290 CG10472-PA 47..279 27..260 585 50.2 Plus
Jon65Aiv-PA 271 CG6467-PA 28..265 17..260 545 46.3 Plus
yip7-PA 270 CG6457-PA 1..264 2..260 499 42 Plus