Clone AT08088 Report

Search the DGRC for AT08088

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:80
Well:88
Vector:pOTB7
Associated Gene/TranscriptCG18810-RA
Protein status:AT08088.pep: gold
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18810 2008-04-29 Release 5.5 accounting
CG18810 2008-04-29 Picked prior to 5.5
CG18810 2008-08-15 Release 5.9 accounting
CG18810 2008-12-18 5.12 accounting

Clone Sequence Records

AT08088.complete Sequence

1076 bp assembled on 2007-09-24

GenBank Submission: BT030752

> AT08088.complete
ATCACTTTCGTTATAATGAGGTTTCGGTCGCTGAAGAACATATGGCCAAA
AGAGAAGTTGGAGCAATTCCTATTTTTGTTCATTTTATGTGGCTTGCCCG
CCATATACTATGTTCTAATGGAGATAATTCTGCCGGAGTTGTCGGATTAT
TGGTCACCTGGTTACGTATTTCAGCTGCTGCTGGGACTGTTCCTCTTTTC
GAATGTGATGTCCAACTATGTCATGTGCATCCTGGTGGACCCCAGCATCG
ATCCCAAGCTTATGAAGAATCAGTTGGTGCGCGGACAGCACAGTGAGGAC
TGGCACGAGTGCGACAAGTGCGGGATTCTTGCTCCACCCCGGTCACGTCA
CTGCAGGAAGTGTGGCGTCTGTGTCCTGATGCGAGATCATCACTGCTTCT
TTACTGGTTGCTGCATCGGTCATGAGAACTATAGATACTTTTTCTATTTT
CTTATCTACTTCTTTCTAAGCTGCATGATTTCACTAACGTCATCTTCGAT
ATTTATTTACGTTCTGCATGGGGGCAGATACCAGCTCTTTATGCTGACAC
ATCCCGCACCGAACTCTGCCTATTTTAACTCGCTTATTATCAGGATAATC
TACTTTAAGTTGCCCGATATATACGAGCTGGTGTTCACTCTGGTATTCGT
CCTGCTGTGGATCGGGGTATGCGTAGCTACCTATGTGGCTTATGATCAGT
GGTCTCGTGGCTATTTTTGCTATGATTTTGAACTTCAAAACATTCCTTTT
GACCGAAAACTGCGCCGAAACTTCAAGACGTTCTTGGGCAGGCGAATGAA
GTGGACCTGGATCTCCGGATTTGTTCCCAGCCAGCTGGACCACGACGGAT
TTGATCTGGATCCCGACAACGAACGTGTGGCAGATTGGTGCTCAGAAACA
ACCATCAAGGATGGCTAAATAATTTTATGCATTCTTTGTGTTTTCCAAAT
TACCGGTGCGATGAAAAATTAAAAATTCGAATTCATTTGATTAGTTGAGG
AATGCAAGAAAGCTTTCCAAATTAAAAAGTTAAATATTTAAAGATGTGTT
ATTATGCGAAAAAAAAAAAAAAAAAA

AT08088.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG18810-RA 1058 CG18810-RA 1..1058 1..1058 5215 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20647468..20648525 1..1058 5230 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:42:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20649022..20650080 1..1059 5220 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20649022..20650080 1..1059 5220 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 09:49:53 has no hits.

AT08088.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:50:40 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20647468..20648525 1..1058 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:55:58 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..903 16..918 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:57 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..903 16..918 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:37:37 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..903 16..918 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:46:23 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..903 16..918 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:52 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..903 16..918 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:43:20 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..918 1..918 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:56 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..1058 1..1058 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:37:37 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 111..1168 1..1058 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:46:23 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 1..918 1..918 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:52 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
CG18810-RA 111..1168 1..1058 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:40 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20649022..20650079 1..1058 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:40 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20649022..20650079 1..1058 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:50:40 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20649022..20650079 1..1058 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:37:37 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20649022..20650079 1..1058 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:52:51 Download gff for AT08088.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20649022..20650079 1..1058 99   Plus

AT08088.hyp Sequence

Translation from 1 to 917

> AT08088.hyp
ITFVIMRFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDY
WSPGYVFQLLLGLFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSED
WHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYF
LIYFFLSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRII
YFKLPDIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPF
DRKLRRNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDPDNERVADWCSET
TIKDG*

AT08088.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG18810-PA 300 CG18810-PA 1..300 6..305 1664 100 Plus
CG4676-PA 284 CG4676-PA 1..275 5..288 447 35.1 Plus
CG10344-PB 278 CG10344-PB 1..268 6..284 382 28.9 Plus
CG10344-PA 198 CG10344-PA 1..166 6..177 341 36.6 Plus
CG13029-PC 288 CG13029-PC 30..276 27..283 337 31.6 Plus

AT08088.pep Sequence

Translation from 15 to 917

> AT08088.pep
MRFRSLKNIWPKEKLEQFLFLFILCGLPAIYYVLMEIILPELSDYWSPGY
VFQLLLGLFLFSNVMSNYVMCILVDPSIDPKLMKNQLVRGQHSEDWHECD
KCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYFF
LSCMISLTSSSIFIYVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLP
DIYELVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLR
RNFKTFLGRRMKWTWISGFVPSQLDHDGFDLDPDNERVADWCSETTIKDG
*

AT08088.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14793-PA 329 GF14793-PA 1..265 1..287 532 36.2 Plus
Dana\GF13019-PA 280 GF13019-PA 1..272 1..283 390 33.5 Plus
Dana\GF13682-PA 283 GF13682-PA 1..273 1..282 371 31.7 Plus
Dana\GF19937-PA 305 GF19937-PA 19..277 22..278 294 32.2 Plus
Dana\GF18232-PA 295 GF18232-PA 44..281 35..278 284 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21243-PA 211 GG21243-PA 1..153 1..153 733 88.2 Plus
Dere\GG20369-PA 283 GG20369-PA 1..274 1..283 411 34.7 Plus
Dere\GG20694-PA 278 GG20694-PA 1..268 1..279 380 31.3 Plus
Dere\GG13586-PA 288 GG13586-PA 9..276 4..278 313 29.9 Plus
Dere\GG12221-PA 281 GG12221-PA 25..277 11..290 280 31.7 Plus
Dere\GG21243-PA 211 GG21243-PA 151..211 240..300 269 80.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20531-PA 286 GH20531-PA 1..270 1..280 392 33.8 Plus
Dgri\GH21619-PA 280 GH21619-PA 12..279 11..287 361 36 Plus
Dgri\GH20532-PA 279 GH20532-PA 17..269 20..280 322 28.1 Plus
Dgri\GH23419-PA 308 GH23419-PA 51..303 38..286 258 29.7 Plus
Dgri\GH25236-PA 308 GH25236-PA 51..303 38..286 255 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG18810-PA 300 CG18810-PA 1..300 1..300 1664 100 Plus
CG4676-PA 284 CG4676-PA 2..275 1..283 446 35.2 Plus
CG10344-PB 278 CG10344-PB 1..268 1..279 382 28.9 Plus
CG10344-PA 198 CG10344-PA 1..166 1..172 341 36.6 Plus
CG13029-PC 288 CG13029-PC 30..276 22..278 337 31.6 Plus
CG17195-PA 283 CG17195-PA 29..274 21..278 317 29 Plus
CG17197-PB 290 CG17197-PB 29..268 21..278 305 29.6 Plus
CG17196-PA 276 CG17196-PA 9..267 4..278 299 28.1 Plus
CG17196-PC 253 CG17196-PC 19..244 29..278 288 30 Plus
CG4956-PA 302 CG4956-PA 41..293 15..278 284 26.4 Plus
CG17196-PB 251 CG17196-PB 32..242 51..278 281 30.3 Plus
CG17198-PB 299 CG17198-PB 45..290 24..278 255 26.2 Plus
CG17198-PA 299 CG17198-PA 45..290 24..278 255 26.2 Plus
CG5196-PB 395 CG5196-PB 3..154 43..195 195 32.9 Plus
CG5196-PA 427 CG5196-PA 35..186 43..195 195 32.9 Plus
CG5880-PA 381 CG5880-PA 99..194 52..154 184 36.9 Plus
app-PO 382 CG42318-PO 131..245 80..199 175 31.7 Plus
app-PI 398 CG42318-PI 131..245 80..199 175 31.7 Plus
app-PH 398 CG42318-PH 131..245 80..199 175 31.7 Plus
app-PR 693 CG42318-PR 131..245 80..199 175 31.7 Plus
app-PM 693 CG42318-PM 131..245 80..199 175 31.7 Plus
app-PL 693 CG42318-PL 131..245 80..199 175 31.7 Plus
app-PT 693 CG42318-PT 131..245 80..199 175 31.7 Plus
app-PK 755 CG42318-PK 131..245 80..199 175 31.7 Plus
app-PJ 755 CG42318-PJ 131..245 80..199 175 31.7 Plus
Dnz1-PA 276 CG6627-PA 97..162 92..157 173 42.4 Plus
CG4483-PA 435 CG4483-PA 36..144 43..149 172 31.5 Plus
CG34449-PG 906 CG34449-PG 53..162 64..167 172 36 Plus
CG34449-PC 500 CG34449-PC 53..167 64..167 167 34.5 Plus
CG34449-PD 523 CG34449-PD 53..167 64..167 167 34.5 Plus
CG34449-PF 852 CG34449-PF 53..167 64..167 167 34.5 Plus
CG34449-PB 911 CG34449-PB 53..167 64..167 167 34.5 Plus
CG34449-PA 934 CG34449-PA 53..167 64..167 167 34.5 Plus
CG34449-PE 1052 CG34449-PE 53..167 64..167 167 34.5 Plus
CG1407-PG 452 CG1407-PG 131..205 99..172 165 40 Plus
CG1407-PB 338 CG1407-PB 131..207 99..174 164 40.3 Plus
CG1407-PD 352 CG1407-PD 131..207 99..174 164 40.3 Plus
CG1407-PE 440 CG1407-PE 131..217 99..177 164 36.8 Plus
CG1407-PA 443 CG1407-PA 131..207 99..174 164 40.3 Plus
CG1407-PC 227 CG1407-PC 131..197 99..164 162 41.8 Plus
CG17287-PA 338 CG17287-PA 22..188 21..155 162 30.2 Plus
CG1407-PF 449 CG1407-PF 131..197 99..164 162 41.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18977-PA 282 GI18977-PA 1..269 1..279 378 30.3 Plus
Dmoj\GI20071-PA 241 GI20071-PA 1..236 39..283 318 38.6 Plus
Dmoj\GI18972-PA 271 GI18972-PA 1..271 15..297 304 31.5 Plus
Dmoj\GI18978-PA 275 GI18978-PA 1..266 1..285 257 30.7 Plus
Dmoj\GI10345-PA 308 GI10345-PA 50..295 38..280 249 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16922-PA 285 GL16922-PA 1..283 1..300 389 28.6 Plus
Dper\GL11193-PA 250 GL11193-PA 1..241 35..283 349 35.2 Plus
Dper\GL23902-PA 381 GL23902-PA 62..367 15..282 191 23.6 Plus
Dper\GL27308-PA 426 GL27308-PA 35..170 43..179 183 33.8 Plus
Dper\GL19029-PA 275 GL19029-PA 23..161 29..157 176 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10260-PA 285 GA10260-PA 1..272 1..279 381 29.7 Plus
Dpse\GA18348-PA 250 GA18348-PA 1..241 35..283 349 35.2 Plus
Dpse\GA10260-PB 256 GA10260-PB 1..174 1..172 324 35.8 Plus
Dpse\GA18553-PB 302 GA18553-PB 62..293 39..280 261 28.8 Plus
Dpse\GA27100-PA 381 GA27100-PA 62..367 15..282 191 23.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23360-PA 300 GM23360-PA 1..300 1..300 1342 95 Plus
Dsec\GM21456-PA 283 GM21456-PA 1..274 1..283 417 34 Plus
Dsec\GM15639-PA 226 GM15639-PA 29..195 1..173 316 36.4 Plus
Dsec\GM25666-PA 288 GM25666-PA 30..276 22..278 287 29.7 Plus
Dsec\GM10219-PA 283 GM10219-PA 30..274 22..278 284 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24271-PA 300 GD24271-PA 1..300 1..300 1316 93.3 Plus
Dsim\GD10954-PA 283 GD10954-PA 1..274 1..283 425 34.7 Plus
Dsim\GD25128-PA 278 GD25128-PA 1..277 1..287 362 30 Plus
Dsim\GD14673-PA 288 GD14673-PA 30..276 22..278 299 30.4 Plus
Dsim\GD18170-PA 283 GD18170-PA 30..274 22..278 282 28.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21165-PA 248 GJ21165-PA 4..247 35..287 399 38.6 Plus
Dvir\GJ19937-PA 287 GJ19937-PA 1..271 1..280 372 31 Plus
Dvir\GJ21996-PA 269 GJ21996-PA 1..257 1..279 321 30.1 Plus
Dvir\GJ10196-PA 321 GJ10196-PA 61..305 38..278 268 32.3 Plus
Dvir\GJ19938-PA 213 GJ19938-PA 1..208 64..284 250 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14088-PA 279 GK14088-PA 1..279 1..286 368 34.7 Plus
Dwil\GK20822-PA 269 GK20822-PA 1..269 1..286 301 28.2 Plus
Dwil\GK18990-PA 278 GK18990-PA 35..268 38..278 293 30.8 Plus
Dwil\GK18989-PA 273 GK18989-PA 47..264 55..278 240 28.8 Plus
Dwil\GK14400-PA 422 GK14400-PA 35..186 43..195 190 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13316-PA 291 GE13316-PA 1..287 1..282 1211 84.3 Plus
Dyak\GE12528-PA 283 GE12528-PA 1..274 1..283 423 34.7 Plus
Dyak\GE11678-PA 278 GE11678-PA 1..268 1..279 365 30.8 Plus
Dyak\GE19883-PA 288 GE19883-PA 30..276 22..278 307 29.9 Plus
Dyak\GE10667-PA 276 GE10667-PA 9..267 4..278 281 27 Plus