Clone AT08725 Report

Search the DGRC for AT08725

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:87
Well:25
Vector:pOTB7
Associated Gene/TranscriptCG31468-RA
Protein status:AT08725.pep: gold
Sequenced Size:466

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31468 2001-12-16 Blastp of sequenced clone
CG10251 2002-01-01 Sim4 clustering to Release 2
CG31468 2003-01-01 Sim4 clustering to Release 3
CG31468 2008-04-29 Release 5.5 accounting
CG31468 2008-08-15 Release 5.9 accounting
CG31468 2008-12-18 5.12 accounting

Clone Sequence Records

AT08725.complete Sequence

466 bp (466 high quality bases) assembled on 2001-12-16

GenBank Submission: AY070779

> AT08725.complete
CTCGTTCGGCAAACAACTCTTTTTAGAGTTTCAAAATTTTACATATTTCT
AAAAATAACTTACAGTTCCTGACCTTTCGTAACCTTTGCATACGCTCATC
GATTCCAAAACTTCGCTAAAATAAATAAATTTTGAAATCGTTAGTTTAAA
AGCATGTCGTGCAATCGTTCTTTTGGACCTGGCCCTGGTGCCTACAATCT
GCCCAGCACCTTTGGGTTTAAGAACTGCGACAAGAGGATGCAGCGAAGTC
CACAGTTCTCATTTGGCAGATCGTCGAGGGCGTGTAATAGTCCTAGGATA
CCGCAGGGACCCGGCCCAGCAGATTATCATGTGGGCAAAATAACGCGATA
TGGACGTCCTGCATCGGAGGACTTCAATGTTTATCGTCGTCGCTAATGGG
TTAAGGAATTTGTTTAAGGAGTAGTAAATAAATGGAAATATTTAACTAAA
AAAAAAAAAAAAAAAA

AT08725.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-RA 644 CG31468-RA 30..478 1..449 2245 100 Plus
CG31468.a 952 CG31468.a 25..473 1..449 2245 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19523251..19523527 447..171 1340 98.9 Minus
chr3R 27901430 chr3R 19523582..19523757 176..1 880 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:43:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:39:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23699846..23700124 449..171 1380 99.6 Minus
3R 32079331 3R 23700179..23700354 176..1 880 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23440677..23440955 449..171 1380 99.6 Minus
3R 31820162 3R 23441010..23441185 176..1 880 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:39:47 has no hits.

AT08725.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:40:40 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19523251..19523522 176..447 99 <- Minus
chr3R 19523583..19523757 1..175 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:56:46 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 154..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:24 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 154..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:34 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 154..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:32 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 154..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:08:11 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..243 154..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:40 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:23 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:34 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:32 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..447 1..447 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:08:11 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
CG31468-RA 1..447 1..447 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:40 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23699848..23700119 176..447 100 <- Minus
3R 23700180..23700354 1..175 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:40 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23699848..23700119 176..447 100 <- Minus
3R 23700180..23700354 1..175 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:40 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23699848..23700119 176..447 100 <- Minus
3R 23700180..23700354 1..175 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:34 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19525570..19525841 176..447 100 <- Minus
arm_3R 19525902..19526076 1..175 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:27 Download gff for AT08725.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23440679..23440950 176..447 100 <- Minus
3R 23441011..23441185 1..175 100   Minus

AT08725.pep Sequence

Translation from 153 to 395

> AT08725.pep
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRR*

AT08725.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18747-PA 90 GF18747-PA 1..79 1..77 256 62 Plus
Dana\GF18749-PA 225 GF18749-PA 1..64 1..67 164 50.7 Plus
Dana\GF15827-PA 79 GF15827-PA 1..67 1..79 138 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12414-PA 80 GG12414-PA 1..80 1..80 373 87.5 Plus
Dere\GG12416-PA 229 GG12416-PA 4..75 5..79 161 49.3 Plus
Dere\GG23676-PA 79 GG23676-PA 1..67 3..79 152 48.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13919-PA 229 GH13919-PA 2..72 3..76 157 43.2 Plus
Dgri\GH13587-PA 81 GH13587-PA 6..69 8..79 147 47.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PB 80 CG31468-PB 1..80 1..80 446 100 Plus
CG31468-PA 80 CG31468-PA 1..80 1..80 446 100 Plus
CG10252-PA 229 CG10252-PA 4..75 5..79 176 49.3 Plus
CG31870-PD 79 CG31870-PD 2..67 4..79 167 48.7 Plus
CG31870-PA 79 CG31870-PA 2..67 4..79 167 48.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes154-PA 229 GI24832-PA 6..72 7..76 153 44.3 Plus
Dmoj\GI24833-PA 229 GI24833-PA 6..63 7..67 142 51.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13833-PA 62 GL13833-PA 1..51 29..80 149 53.8 Plus
Dper\GL13835-PA 229 GL13835-PA 4..72 5..76 144 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16271-PA 74 GA16271-PA 2..65 16..80 191 53.8 Plus
Dpse\GA26812-PA 229 GA26812-PA 4..72 5..76 142 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23548-PA 81 GM23548-PA 1..81 1..80 369 91.4 Plus
Dsec\GM18736-PA 81 GM18736-PA 1..81 1..80 369 91.4 Plus
Dsec\GM26710-PA 81 GM26710-PA 1..81 1..80 369 91.4 Plus
Dsec\GM23550-PA 229 GM23550-PA 4..75 5..79 160 49.3 Plus
Dsec\GM18739-PA 79 GM18739-PA 1..67 3..79 148 48.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18362-PA 81 GD18362-PA 1..81 1..80 373 92.6 Plus
Dsim\GD18365-PA 229 GD18365-PA 4..75 5..79 160 49.3 Plus
Dsim\GD23733-PA 79 GD23733-PA 1..67 3..79 146 46.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20745-PA 87 GJ20745-PA 3..75 5..79 188 50.6 Plus
Dvir\GJ24476-PA 225 GJ24476-PA 1..68 6..76 155 45.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14096-PA 229 GK14096-PA 4..75 5..79 148 44 Plus
Dwil\GK14097-PA 229 GK14097-PA 4..72 5..76 145 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23933-PA 81 GE23933-PA 1..80 1..79 349 85 Plus
Dyak\GE23935-PA 229 GE23935-PA 4..75 5..79 161 49.3 Plus
Dyak\GE18489-PA 79 GE18489-PA 1..67 3..79 150 49.4 Plus

AT08725.hyp Sequence

Translation from 153 to 395

> AT08725.hyp
MSCNRSFGPGPGAYNLPSTFGFKNCDKRMQRSPQFSFGRSSRACNSPRIP
QGPGPADYHVGKITRYGRPASEDFNVYRRR*

AT08725.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31468-PB 80 CG31468-PB 1..80 1..80 446 100 Plus
CG31468-PA 80 CG31468-PA 1..80 1..80 446 100 Plus
CG10252-PA 229 CG10252-PA 4..75 5..79 176 49.3 Plus
CG31870-PD 79 CG31870-PD 2..67 4..79 167 48.7 Plus
CG31870-PA 79 CG31870-PA 2..67 4..79 167 48.7 Plus