Clone AT09290 Report

Search the DGRC for AT09290

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:92
Well:90
Vector:pOTB7
Associated Gene/TranscriptCG10014-RA
Protein status:AT09290.pep: gold
Preliminary Size:1354
Sequenced Size:1473

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10014 2002-01-01 Sim4 clustering to Release 2
CG10014 2002-03-20 Blastp of sequenced clone
CG10014 2003-01-01 Sim4 clustering to Release 3
CG10014 2008-04-29 Release 5.5 accounting
CG10014 2008-08-15 Release 5.9 accounting
CG10014 2008-12-18 5.12 accounting

Clone Sequence Records

AT09290.complete Sequence

1473 bp (1473 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094644

> AT09290.complete
GGATTTCAAAACTGAACCATTTCCGAATTATTATCTTCTTCTCAGCTAAA
CTGTTCAAAATTATAGAATTTTGCTTTATACTTTTGAAAAACGAAGATGA
ATTACTTGATACAGCGTGGCAAGATGCGCCAGCAGGCGATTAATGTTCCA
GAGGGTCTGCCGGAACTTCTATCAGATGTTACACGGGAGGTGCTAAGGTG
TCAGCCGAAGAAAGAGTGCCTCTGCCAGTTCATCATCGACTATCTACATT
CGGTGATCGTGACAAGGGAAAAGGCTATGGTGGCCAAGACCATTTTGGAT
CGCTCTCTGCGCCAGGTGGACAGCATAATATCGGACCTCTGTGTCTGTGA
TCTCTCCAAGGAGAAGTCCGAGTTGATGGGCCAGGTTCTAGAGGACTGTT
TCCGTAACTTCCTCGAGAAACGACGCTGCGAGATGCGGCGTGGCAAGCAG
GCGATTAAGTTCGAGGATGTGGACATCCTAGAGGAGCTGCTGCAGAAGTG
CAAGTTTACCGACGAGGAGCTGGTCATGTCACGGCCGGCCATCGAGAGTG
CCTACAAGCGCTTCGTGGACGCCTATATGTCCGCCGAACGTGGAGCCGAT
GGAACGGAGCTACTCTACCAGTACTTCCGGGACAGGGAACTGAAGCGTAT
CAACGAGGCCATGCGCAACCAGGCAGCCATCACGATCCAGGCGGCTTGGC
GAGGATACTGGGTTCGCCTCCAGTTCCCGCAAGAAGTTTGCGTTTGTGTC
TGCGCAGCGGAAAAAGAGGACGACGGGGAGGAAAAGCGCAGGGAACAGGC
AGCGAGCGTTCTTCAGAGATTCTTCCGCAAGGTTATGTTGCGCGTGGTTA
CCAAGCCAATCGTAGACCCCTGTGCCGAACCAACGGAACCAACTGAAGTG
GATGCTAGCTCTTCACCGGATACAGCAAAGGATGGCTATGACGACGTAAA
TCTCTCGACAGTACCAACAACTGCTGCGATAACAGCCGGACCAACACCAT
TACCAACTGCTCCCGGAACTGTGCCGCCATCTGCCCCAGGCACTGCTCCG
GCCACGGCCAGAACTTCGGCCACTGCTATAGCAGAGCCAGAAGCTCATGA
AGAGGCTGCGGAAGCTCAGCCAGCGGAGGAAGCTCCTGCAGCAGAGGCGC
CTGCTGATGAAGCAGCACCAGCTCCGGCTGAGGAGGCTGCCCCACCGCCA
GCAGAAGAGGCTGCACCGGAAGCCGCCGAAGAGCCGGCACCTCCACCACC
ACCAGAAGAAGCAGCGGCACCGCCACCGCCCGCTGAGGAGCCCGCTCCGA
CAGAGGGAGCAGCTCCTCCCGCTGAAGAAGCTCCCGCAGAAGAAGCTCCC
GCAGCTGAGTAGATGAAACCATGCTGTGTTTATTAATTTTCCCTTAGTTG
TTAAATTGATGTTATCTGCAAGTGAATAAACTGATCGAAAAGTGCTGGAA
AAAAAAAAAAAAAAAAAAAAAAA

AT09290.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG10014-RA 1480 CG10014-RA 33..1480 1..1448 7210 99.8 Plus
CG17404-RB 1010 CG17404-RB 951..1010 1450..1391 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:19:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8048831..8049439 840..1448 3000 99.5 Plus
chr3R 27901430 chr3R 8048124..8048604 280..760 2405 100 Plus
chr3R 27901430 chr3R 8047778..8048057 1..280 1385 99.6 Plus
chr3R 27901430 chr3R 8048663..8048744 759..840 410 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:43:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12223440..12224050 840..1450 3040 99.8 Plus
3R 32079331 3R 12222733..12223213 280..760 2405 100 Plus
3R 32079331 3R 12222387..12222666 1..280 1385 99.6 Plus
3R 32079331 3R 12223272..12223353 759..840 410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11964271..11964881 840..1450 3040 99.8 Plus
3R 31820162 3R 11963564..11964044 280..760 2405 100 Plus
3R 31820162 3R 11963218..11963497 1..280 1385 99.6 Plus
3R 31820162 3R 11964103..11964184 759..840 410 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:19:26 has no hits.

AT09290.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:20:40 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8047778..8048057 1..280 99 -> Plus
chr3R 8048125..8048603 281..759 100 -> Plus
chr3R 8048664..8048744 760..840 100 -> Plus
chr3R 8048832..8049439 841..1448 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:27:22 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1266 97..1362 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 13:27:46 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1266 97..1362 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:02:14 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1266 97..1362 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:43:07 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1266 97..1362 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:53:58 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1448 1..1448 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:27:22 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1448 1..1448 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:27:46 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1448 1..1448 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:02:15 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1448 1..1448 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:43:07 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
CG10014-RA 1..1448 1..1448 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:40 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12222387..12222666 1..280 99 -> Plus
3R 12222734..12223212 281..759 100 -> Plus
3R 12223273..12223353 760..840 100 -> Plus
3R 12223441..12224048 841..1448 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:40 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12222387..12222666 1..280 99 -> Plus
3R 12222734..12223212 281..759 100 -> Plus
3R 12223273..12223353 760..840 100 -> Plus
3R 12223441..12224048 841..1448 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:20:40 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12222387..12222666 1..280 99 -> Plus
3R 12222734..12223212 281..759 100 -> Plus
3R 12223273..12223353 760..840 100 -> Plus
3R 12223441..12224048 841..1448 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:27:46 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8048109..8048388 1..280 99 -> Plus
arm_3R 8048456..8048934 281..759 100 -> Plus
arm_3R 8048995..8049075 760..840 100 -> Plus
arm_3R 8049163..8049770 841..1448 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:35:32 Download gff for AT09290.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11963218..11963497 1..280 99 -> Plus
3R 11963565..11964043 281..759 100 -> Plus
3R 11964104..11964184 760..840 100 -> Plus
3R 11964272..11964879 841..1448 99   Plus

AT09290.hyp Sequence

Translation from 96 to 1361

> AT09290.hyp
MNYLIQRGKMRQQAINVPEGLPELLSDVTREVLRCQPKKECLCQFIIDYL
HSVIVTREKAMVAKTILDRSLRQVDSIISDLCVCDLSKEKSELMGQVLED
CFRNFLEKRRCEMRRGKQAIKFEDVDILEELLQKCKFTDEELVMSRPAIE
SAYKRFVDAYMSAERGADGTELLYQYFRDRELKRINEAMRNQAAITIQAA
WRGYWVRLQFPQEVCVCVCAAEKEDDGEEKRREQAASVLQRFFRKVMLRV
VTKPIVDPCAEPTEPTEVDASSSPDTAKDGYDDVNLSTVPTTAAITAGPT
PLPTAPGTVPPSAPGTAPATARTSATAIAEPEAHEEAAEAQPAEEAPAAE
APADEAAPAPAEEAAPPPAEEAAPEAAEEPAPPPPPEEAAAPPPPAEEPA
PTEGAAPPAEEAPAEEAPAAE*

AT09290.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG10014-PA 421 CG10014-PA 1..421 1..421 2176 100 Plus
Tm1-PF 501 CG4898-PF 354..497 287..421 210 46.3 Plus
Tm1-PF 501 CG4898-PF 343..501 260..420 209 41.7 Plus
Tm1-PK 518 CG4898-PK 319..510 260..420 189 39.2 Plus
CG18130-PA 706 CG18130-PA 582..684 312..418 186 48.6 Plus
CG10869-PA 659 CG10869-PA 78..155 335..418 184 52.4 Plus
Tm1-PK 518 CG4898-PK 366..518 258..409 183 40.7 Plus
Tm1-PK 518 CG4898-PK 295..490 253..421 182 36.4 Plus
CG18130-PA 706 CG18130-PA 583..682 324..421 169 49.1 Plus
CG18130-PA 706 CG18130-PA 594..706 310..421 163 47.1 Plus

AT09290.pep Sequence

Translation from 96 to 1361

> AT09290.pep
MNYLIQRGKMRQQAINVPEGLPELLSDVTREVLRCQPKKECLCQFIIDYL
HSVIVTREKAMVAKTILDRSLRQVDSIISDLCVCDLSKEKSELMGQVLED
CFRNFLEKRRCEMRRGKQAIKFEDVDILEELLQKCKFTDEELVMSRPAIE
SAYKRFVDAYMSAERGADGTELLYQYFRDRELKRINEAMRNQAAITIQAA
WRGYWVRLQFPQEVCVCVCAAEKEDDGEEKRREQAASVLQRFFRKVMLRV
VTKPIVDPCAEPTEPTEVDASSSPDTAKDGYDDVNLSTVPTTAAITAGPT
PLPTAPGTVPPSAPGTAPATARTSATAIAEPEAHEEAAEAQPAEEAPAAE
APADEAAPAPAEEAAPPPAEEAAPEAAEEPAPPPPPEEAAAPPPPAEEPA
PTEGAAPPAEEAPAEEAPAAE*

AT09290.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17235-PA 433 GF17235-PA 1..342 1..350 1224 72.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18662-PA 427 GG18662-PA 1..336 1..328 1551 89.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17315-PA 402 GH17315-PA 1..363 1..369 950 55.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG10014-PA 421 CG10014-PA 1..421 1..421 2176 100 Plus
Tm1-PF 501 CG4898-PF 354..497 287..421 210 46.3 Plus
Tm1-PF 501 CG4898-PF 343..501 260..420 209 41.7 Plus
Tm1-PK 518 CG4898-PK 319..510 260..420 189 39.2 Plus
CG18130-PA 706 CG18130-PA 582..684 312..418 186 48.6 Plus
CG10869-PA 659 CG10869-PA 78..155 335..418 184 52.4 Plus
Tm1-PK 518 CG4898-PK 366..518 258..409 183 40.7 Plus
Tm1-PK 518 CG4898-PK 295..490 253..421 182 36.4 Plus
Muc55B-PB 485 CG5765-PB 226..422 250..420 181 31.5 Plus
Muc55B-PA 485 CG5765-PA 226..422 250..420 181 31.5 Plus
CG15021-PA 420 CG15021-PA 76..255 254..418 171 29.4 Plus
CG18130-PA 706 CG18130-PA 583..682 324..421 169 49.1 Plus
Muc55B-PB 485 CG5765-PB 199..338 288..420 164 34.3 Plus
Muc55B-PA 485 CG5765-PA 199..338 288..420 164 34.3 Plus
CG18130-PA 706 CG18130-PA 594..706 310..421 163 47.1 Plus
CG10869-PA 659 CG10869-PA 75..179 317..418 161 46.8 Plus
CG10869-PA 659 CG10869-PA 70..173 322..419 160 46.7 Plus
CG15021-PA 420 CG15021-PA 268..388 299..416 157 33.1 Plus
Muc55B-PB 485 CG5765-PB 276..436 250..420 156 29.9 Plus
Muc55B-PA 485 CG5765-PA 276..436 250..420 156 29.9 Plus
CG14218-PC 219 CG14218-PC 72..208 290..415 153 32.4 Plus
CG14218-PB 350 CG14218-PB 72..208 290..415 153 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10276-PA 385 GI10276-PA 1..346 1..379 1037 59.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22269-PA 430 GL22269-PA 1..356 1..349 1165 65.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10009-PA 438 GA10009-PA 1..342 1..337 1145 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24003-PA 421 GM24003-PA 1..335 1..335 1733 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18804-PA 421 GD18804-PA 1..328 1..328 1698 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:59:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11535-PA 427 GK11535-PA 1..426 1..403 1174 56.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:59:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26164-PA 425 GE26164-PA 1..336 1..328 1556 89 Plus