Clone AT09395 Report

Search the DGRC for AT09395

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:93
Well:95
Vector:pOTB7
Associated Gene/TranscriptCG33098-RC
Protein status:AT09395.pep: gold
Preliminary Size:1728
Sequenced Size:922

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17756 2002-01-01 Sim4 clustering to Release 2
CG33098 2002-02-27 Blastp of sequenced clone
CG33098 2003-01-01 Sim4 clustering to Release 3
CG33098 2008-04-29 Release 5.5 accounting
CG33098 2008-08-15 Release 5.9 accounting
CG33098 2008-12-18 5.12 accounting

Clone Sequence Records

AT09395.complete Sequence

922 bp (922 high quality bases) assembled on 2002-02-27

GenBank Submission: AY084110

> AT09395.complete
AAAGAGTTGGTAGTGCAAAAACTCCGTCAAAATGTCGATGGATCCATCGG
TTTCTCTAGAGGATCTGGAGCGACGTCGTCGTCGCGCCAGTTCCGCCCGC
AAGCAGTCACATACTCCCCAGCCAGCATCTCACCTGGCGGATTCGGAGGC
CATGGCCGTAATCAATGAGATATTTAATCCCACGCTGAAGCTGCCGGAGT
CCAGTGGCCACTATACGCTGCCCGAGGAGATGAGGGCCGATGATAATGTG
GCGCCCCATGAACTGGACATTGCCAAGCTGGCGGAGCTGAAGGAAGTCTT
CTCGCTCTTCGATACGGACTGCGATGGACTGATCTCGAAGGATGATCTAC
GGTTCACCTACACGGCGCTGGGCAACGAACCGAACGAACAGCTACTGGAA
CAGATGATGCAGGAGGCCAAGGAGCCGCTCGACTATGAAGCCTTCGTTCG
GCTGATGAGTCGTCGCACCCAGGAACTGGATCCCGAGGATGTTTTGTTGG
AGGCCTGGAGCAAATGGGATGACCATGGCACGGGCAAGATCGACGAACGC
AAGTGGGTGCTACCGGGTAGAGTGGACTACCACAGTGATAGTCTCCATTT
TGAACACTCCCCAGAATCTATGAAGAGCTGACCAACTATGGTGACAAAAT
GACCCTCAACGAGGCCAAGGAGGCTCTTAGCCACGCCCCGATGGCCAAGC
CCAAGTCCTTGGAGGAGCCGCCCATGATCGATTACCCGGCCTTCTGTCGC
ATGCTAAGTGGAATGCGGAAGCGGAAAGGGGAATAACGTGCTATTTTTGG
GAGAAACTTTAAAAGTTTACTTTAAATTCAAATCCATTAAATATTTTCTG
ATTTAATGTTTTTTTTTTTCAGTTAACCTACTAATATACAAGCTCTTTCA
TTTCAAAAAAAAAAAAAAAAAA

AT09395.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:23:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098-RC 1015 CG33098-RC 1..903 1..905 4470 99.7 Plus
CG33098-RB 1077 CG33098-RB 26..577 1..552 2760 100 Plus
CG33098.a 1293 CG33098.a 242..793 1..552 2760 100 Plus
CG33098-RB 1077 CG33098-RB 578..866 615..905 1400 99.3 Plus
CG33098.a 1293 CG33098.a 794..1082 615..905 1400 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8213361..8213971 296..904 2905 99 Plus
chr3R 27901430 chr3R 8213087..8213310 74..297 1120 100 Plus
chr3R 27901430 chr3R 8212947..8213019 1..73 365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:43:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12387979..12388586 296..905 2985 99.7 Plus
3R 32079331 3R 12387705..12387928 74..297 1120 100 Plus
3R 32079331 3R 12387565..12387637 1..73 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12128810..12129417 296..905 2995 99.6 Plus
3R 31820162 3R 12128536..12128759 74..297 1120 100 Plus
3R 31820162 3R 12128396..12128468 1..73 365 100 Plus
Blast to na_te.dros performed on 2019-03-16 16:49:41 has no hits.

AT09395.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:50:31 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8212947..8213019 1..73 100 -> Plus
chr3R 8213087..8213308 74..295 100 -> Plus
chr3R 8213361..8213971 296..904 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:57:31 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..600 32..631 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:33:10 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..600 32..631 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:42 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..600 32..631 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:05:48 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..600 32..631 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:44:41 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..600 32..631 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:59:07 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..902 1..904 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:33:10 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..902 1..904 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:42 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..902 1..904 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:05:48 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..902 1..904 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:44:41 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
CG33098-RC 1..902 1..904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:31 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387565..12387637 1..73 100 -> Plus
3R 12387705..12387926 74..295 100 -> Plus
3R 12387979..12388585 296..904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:31 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387565..12387637 1..73 100 -> Plus
3R 12387705..12387926 74..295 100 -> Plus
3R 12387979..12388585 296..904 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:50:31 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12387565..12387637 1..73 100 -> Plus
3R 12387705..12387926 74..295 100 -> Plus
3R 12387979..12388585 296..904 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:42 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8213287..8213359 1..73 100 -> Plus
arm_3R 8213427..8213648 74..295 100 -> Plus
arm_3R 8213701..8214307 296..904 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:39:36 Download gff for AT09395.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12128536..12128757 74..295 100 -> Plus
3R 12128810..12129416 296..904 99   Plus
3R 12128396..12128468 1..73 100 -> Plus

AT09395.hyp Sequence

Translation from 31 to 630

> AT09395.hyp
MSMDPSVSLEDLERRRRRASSARKQSHTPQPASHLADSEAMAVINEIFNP
TLKLPESSGHYTLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGL
ISKDDLRFTYTALGNEPNEQLLEQMMQEAKEPLDYEAFVRLMSRRTQELD
PEDVLLEAWSKWDDHGTGKIDERKWVLPGRVDYHSDSLHFEHSPESMKS*

AT09395.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098-PC 199 CG33098-PC 1..199 1..199 1041 100 Plus
CG33098-PF 230 CG33098-PF 1..174 1..174 900 100 Plus
CG33098-PE 230 CG33098-PE 1..174 1..174 900 100 Plus
CG33098-PB 230 CG33098-PB 1..174 1..174 900 100 Plus
CG33098-PD 164 CG33098-PD 1..108 67..174 566 100 Plus

AT09395.pep Sequence

Translation from 31 to 630

> AT09395.pep
MSMDPSVSLEDLERRRRRASSARKQSHTPQPASHLADSEAMAVINEIFNP
TLKLPESSGHYTLPEEMRADDNVAPHELDIAKLAELKEVFSLFDTDCDGL
ISKDDLRFTYTALGNEPNEQLLEQMMQEAKEPLDYEAFVRLMSRRTQELD
PEDVLLEAWSKWDDHGTGKIDERKWVLPGRVDYHSDSLHFEHSPESMKS*

AT09395.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17950-PA 230 GF17950-PA 1..174 1..174 831 93.7 Plus
Dana\GF20304-PA 174 GF20304-PA 19..122 68..172 181 37.1 Plus
Dana\GF12835-PA 149 GF12835-PA 9..101 82..170 151 35.5 Plus
Dana\GF22746-PA 184 GF22746-PA 35..133 76..170 143 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18839-PA 230 GG18839-PA 1..174 1..174 892 97.7 Plus
Dere\GG17688-PA 174 GG17688-PA 19..122 68..172 181 37.1 Plus
Dere\GG20265-PA 149 GG20265-PA 9..101 82..170 151 35.5 Plus
Dere\GG21714-PA 186 GG21714-PA 36..135 75..170 141 32 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20591-PA 228 GH20591-PA 1..173 1..174 721 85.1 Plus
Dgri\GH24837-PA 174 GH24837-PA 19..122 68..172 182 37.1 Plus
Dgri\GH22800-PA 122 GH22800-PA 3..104 73..170 151 34.3 Plus
Dgri\GH10976-PA 190 GH10976-PA 42..139 77..170 144 33.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG33098-PC 199 CG33098-PC 1..199 1..199 1041 100 Plus
CG33098-PF 230 CG33098-PF 1..174 1..174 900 100 Plus
CG33098-PE 230 CG33098-PE 1..174 1..174 900 100 Plus
CG33098-PB 230 CG33098-PB 1..174 1..174 900 100 Plus
CG33098-PD 164 CG33098-PD 1..108 67..174 566 100 Plus
sqh-PE 174 CG3595-PE 13..122 62..172 184 36 Plus
sqh-PD 174 CG3595-PD 13..122 62..172 184 36 Plus
sqh-PC 174 CG3595-PC 13..122 62..172 184 36 Plus
sqh-PB 174 CG3595-PB 13..122 62..172 184 36 Plus
sqh-PA 174 CG3595-PA 13..122 62..172 184 36 Plus
Cam-PD 149 CG8472-PD 4..101 77..170 149 34.7 Plus
Cam-PC 149 CG8472-PC 4..101 77..170 149 34.7 Plus
Cam-PE 149 CG8472-PE 4..101 77..170 149 34.7 Plus
Cam-PB 149 CG8472-PB 4..101 77..170 149 34.7 Plus
Cam-PA 149 CG8472-PA 4..101 77..170 149 34.7 Plus
CG31802-PA 186 CG31802-PA 38..135 77..170 144 32.7 Plus
Mlc2-PA 222 CG2184-PA 23..163 19..166 143 28.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23199-PA 520 GI23199-PA 1..175 1..174 719 85.7 Plus
Dmoj\GI16168-PA 174 GI16168-PA 19..122 68..172 184 37.1 Plus
Dmoj\GI20594-PA 149 GI20594-PA 9..101 82..170 151 35.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27306-PA 230 GL27306-PA 1..174 1..174 764 90.2 Plus
Dper\GL10814-PA 149 GL10814-PA 9..101 82..170 151 35.5 Plus
Dper\GL26165-PA 192 GL26165-PA 43..141 76..170 144 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17278-PA 230 GA17278-PA 1..174 1..174 764 90.2 Plus
Dpse\GA17546-PA 174 GA17546-PA 19..122 68..172 181 37.1 Plus
Dpse\GA15288-PB 222 GA15288-PB 76..170 82..175 159 34 Plus
Dpse\GA24499-PA 149 GA24499-PA 9..101 82..170 151 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11055-PA 226 GM11055-PA 1..174 1..174 917 100 Plus
Dsec\GM24024-PA 230 GM24024-PA 1..174 1..174 915 100 Plus
Dsec\GM11056-PA 230 GM11056-PA 1..174 1..174 915 100 Plus
Dsec\GM19686-PA 141 GM19686-PA 1..114 1..114 591 98.2 Plus
Dsec\GM12587-PA 174 GM12587-PA 19..122 68..172 181 37.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18824-PA 196 GD18824-PA 1..193 1..193 991 97.4 Plus
Dsim\sqh-PA 174 GD16204-PA 19..122 68..172 181 37.1 Plus
Dsim\GD10849-PA 149 GD10849-PA 9..101 82..170 151 35.5 Plus
Dsim\GD21839-PA 186 GD21839-PA 36..135 75..170 142 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22859-PA 230 GJ22859-PA 1..175 1..174 743 85.1 Plus
Dvir\GJ19134-PA 174 GJ19134-PA 19..122 68..172 181 37.1 Plus
Dvir\GJ16661-PA 174 GJ16661-PA 19..122 68..172 181 37.1 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 15..133 57..170 144 31.1 Plus
Dvir\GJ15110-PA 190 GJ15110-PA 40..139 75..170 141 33 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11881-PA 230 GK11881-PA 1..174 1..174 793 90.2 Plus
Dwil\GK17694-PA 174 GK17694-PA 19..122 68..172 177 36.2 Plus
Dwil\GK22183-PA 149 GK22183-PA 9..101 82..170 151 35.5 Plus
Dwil\GK13145-PA 222 GK13145-PA 76..170 82..175 151 33 Plus
Dwil\GK15343-PA 197 GK15343-PA 47..146 75..170 140 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26184-PA 230 GE26184-PA 1..174 1..174 890 97.7 Plus
Dyak\sqh-PA 174 GE16476-PA 19..122 68..172 181 37.1 Plus
Dyak\Cam-PA 149 GE12425-PA 9..101 82..170 151 35.5 Plus
Dyak\GE12738-PA 186 GE12738-PA 36..135 75..170 142 32 Plus