Clone AT09528 Report

Search the DGRC for AT09528

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:95
Well:28
Vector:pOTB7
Associated Gene/Transcriptfh-RA
Protein status:AT09528.pep: gold
Preliminary Size:573
Sequenced Size:933

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8971 2002-01-01 Sim4 clustering to Release 2
CG8971 2002-03-20 Blastp of sequenced clone
CG8971 2003-01-01 Sim4 clustering to Release 3
fh 2008-04-29 Release 5.5 accounting
fh 2008-08-15 Release 5.9 accounting
fh 2008-12-18 5.12 accounting

Clone Sequence Records

AT09528.complete Sequence

933 bp (933 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094649

> AT09528.complete
CGCAACTGGGATTTGTAAAATATAAACAAATCGTAAACAACTAAAAAATG
TTTGCCGGTCGTTTGATGGTCCGTTCGATCGTTGGTCGGGCATGCTTGGC
CACCATGGGCAGGTGGTCAAAGCCCCAAGCACACGCCAGCCAAGTGATCC
TGCCCAGCACACCAGCGATAGCCGCAGTTGCTATTCAATGCGAGGAATTC
ACTGCCAACCGGCGATTGTTTAGCAGTCAAATTGAGACGGAATCCACATT
GGACGGCGCCACCTACGAGCGTGTGTGCTCCGACACCCTGGACGCACTGT
GCGACTACTTCGAGGAGCTGACGGAGAACGCCTCCGAGCTGCAGGGCACG
GATGTGGCTTACAGCGATGGCGTGCTAACCGTGAACCTGGGAGGACAGCA
CGGCACCTATGTGATCAACCGGCAGACGCCCAACAAGCAGATCTGGCTCA
GTTCGCCCACCAGCGGTCCCAAGCGATACGATTTCGTCGGCACTGTGGCG
GCGGGCAGATGGATCTACAAGCACAGTGGTCAGTCGCTGCACGAACTGTT
GCAGCAGGAGATACCCGGCATACTGAAGTCACAGTCCGTGGACTTCCTAC
GCCTGCCCTACTGTAGTTAATTCCGTGATTAGTTTAAATTCTCCTCCATA
AAAAGTCGGTTGAAACGTTCGATTTTGATATATTTATTGTTCTTCATCTG
TTGGCACAGTGGTCACTCGATATACATGGAACTGCTGCTGCTGCGGATGA
GCAAAGGTATATACTTATACTTCCCTGGAGCTGTGAAGCTTAGCTTCTGG
TATAAATGCTTTGCATTCGCTTATTCATTTATGTACGATTAGTTTTGGTT
TCGAAGTTTAAATTTGTTGTTTTTGAGAGGAATAAACTTAAAAATCAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT09528.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
fh-RA 1104 fh-RA 115..1011 1..897 4470 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9039899..9040429 896..366 2655 100 Minus
chrX 22417052 chrX 9040498..9040863 366..1 1830 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9148094..9148625 897..366 2645 99.8 Minus
X 23542271 X 9148694..9149059 366..1 1830 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9156192..9156723 897..366 2645 99.8 Minus
X 23527363 X 9156792..9157157 366..1 1830 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:27:37 has no hits.

AT09528.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:28:38 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9039899..9040429 366..896 100 <- Minus
chrX 9040499..9040863 1..365 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:57:45 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..573 48..620 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:27:09 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..573 48..620 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:48:22 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..573 48..620 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:02:08 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..573 48..620 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:53:47 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..573 48..620 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:53:47 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..896 1..896 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:27:09 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..896 1..896 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:48:22 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 13..908 1..896 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:02:08 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 1..896 1..896 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:53:47 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
fh-RA 13..908 1..896 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:38 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
X 9148095..9148625 366..896 99 <- Minus
X 9148695..9149059 1..365 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:38 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
X 9148095..9148625 366..896 99 <- Minus
X 9148695..9149059 1..365 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:28:38 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
X 9148095..9148625 366..896 99 <- Minus
X 9148695..9149059 1..365 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:48:22 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9042128..9042658 366..896 99 <- Minus
arm_X 9042728..9043092 1..365 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:35:22 Download gff for AT09528.complete
Subject Subject Range Query Range Percent Splice Strand
X 9156793..9157157 1..365 100   Minus
X 9156193..9156723 366..896 99 <- Minus

AT09528.hyp Sequence

Translation from 47 to 619

> AT09528.hyp
MFAGRLMVRSIVGRACLATMGRWSKPQAHASQVILPSTPAIAAVAIQCEE
FTANRRLFSSQIETESTLDGATYERVCSDTLDALCDYFEELTENASELQG
TDVAYSDGVLTVNLGGQHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTV
AAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFLRLPYCS*

AT09528.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:59:57
Subject Length Description Subject Range Query Range Score Percent Strand
fh-PA 190 CG8971-PA 1..190 1..190 989 100 Plus
fh-PB 190 CG8971-PB 1..108 1..108 542 99.1 Plus

AT09528.pep Sequence

Translation from 47 to 619

> AT09528.pep
MFAGRLMVRSIVGRACLATMGRWSKPQAHASQVILPSTPAIAAVAIQCEE
FTANRRLFSSQIETESTLDGATYERVCSDTLDALCDYFEELTENASELQG
TDVAYSDGVLTVNLGGQHGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTV
AAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFLRLPYCS*

AT09528.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:59:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19130-PA 189 GF19130-PA 46..189 47..190 624 78.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19001-PA 190 GG19001-PA 1..190 1..190 898 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:59:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12457-PA 185 GH12457-PA 49..182 56..188 500 70.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
fh-PA 190 CG8971-PA 1..190 1..190 989 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15054-PA 189 GI15054-PA 53..189 56..190 426 55.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:59:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26832-PA 190 GL26832-PA 1..190 6..190 631 64.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21445-PA 190 GA21445-PA 55..190 55..190 623 81.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13678-PA 190 GM13678-PA 1..190 1..190 937 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16083-PA 190 GD16083-PA 1..190 1..190 948 93.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14708-PA 153 GJ14708-PA 20..153 56..187 449 61.2 Plus
Dvir\GJ14709-PA 143 GJ14709-PA 11..141 62..190 364 53 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:59:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10087-PA 191 GK10087-PA 58..191 55..190 536 72.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\fh-PA 190 GE17413-PA 1..190 1..190 870 85.3 Plus