Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT09538.complete Sequence
678 bp (678 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113224
> AT09538.complete
AACAATCCTTTCTACGAATCACACGTTCTAACGATAAGTCGTAGATGATA
AATATCACAAAACAATGAGCCAAGAAAATTTTCCGCTTCCAAGTGTAGAA
ACACAAGCCGCAACTGATGAAGGAGGTCCTCCATTACCGCAATCACCTGA
AAACGTTGAGGAAAATGTGAAAGAAACCAAAGAGGTTCAAGAGTCCCAGC
GCTGCAGTAGTTCGAGGATTTTAAATCGGGAACATAAATATAAGCAGCCA
GAATGCAAAGCATCGAGATCAGTGAAAAAAAGGAAAAGGGCAAGGATCCA
TAAACGGAAAAGCACTCTCTACGGAGATCGCGCTGTGAACTGTACCAAGT
GCGGAACTGTCACGATCTATTTTCCGGCCCGCACCAAGTTTTTCTCATGT
GCCGAGATAGATGGTCGATTGTTCAAGGTGAAACGGATCTCGTCCAGAAA
AGTACTTGGTGGTGCTTACCGCAAGCAACCTATGAAGCGTTCGAAATTAC
CGTGCTAAAAATTGTTGTCTACGTTTAGGAAACAAAAGTACAAAATTTAC
TTGAAATGAAGTCTTTAGATTTTTACTTGAACGTAATTTTCTAACTAATT
GTATAACTTTTTATCTAAATTATTCGTACTAGTCTTGTCAAATAAAATAA
AATACTGAATAAAAAAAAAAAAAAAAAA
AT09538.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:11:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30039-RA | 735 | CG30039-RA | 70..717 | 1..648 | 3150 | 99 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:17:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 7938215..7938778 | 648..85 | 2730 | 98.9 | Minus |
chr2R | 21145070 | chr2R | 7938830..7938914 | 85..1 | 425 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12050992..12051555 | 648..85 | 2730 | 98.9 | Minus |
2R | 25286936 | 2R | 12051607..12051691 | 85..1 | 425 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12052191..12052754 | 648..85 | 2730 | 98.9 | Minus |
2R | 25260384 | 2R | 12052806..12052890 | 85..1 | 425 | 100 | Minus |
Blast to na_te.dros performed 2019-03-15 15:17:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
gypsy5 | 7369 | gypsy5 GYPSY5 7369bp | 5489..5563 | 491..567 | 119 | 63.6 | Plus |
invader2 | 5124 | invader2 INVADER2 5124bp | 2400..2441 | 50..91 | 111 | 73.8 | Plus |
AT09538.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:18:02 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 7938215..7938777 | 86..648 | 98 | <- | Minus |
chr2R | 7938830..7938914 | 1..85 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:57:46 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 1..444 | 65..508 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:06 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 1..444 | 65..508 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:22:30 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 1..444 | 65..508 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:27 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 1..444 | 65..508 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 1..444 | 65..508 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:52 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 65..712 | 1..648 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:06 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 65..712 | 1..648 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:22:30 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 65..712 | 1..648 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:27 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 65..712 | 1..648 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30039-RA | 65..712 | 1..648 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12050992..12051554 | 86..648 | 98 | <- | Minus |
2R | 12051607..12051691 | 1..85 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12050992..12051554 | 86..648 | 98 | <- | Minus |
2R | 12051607..12051691 | 1..85 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12050992..12051554 | 86..648 | 98 | <- | Minus |
2R | 12051607..12051691 | 1..85 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:22:30 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7938497..7939059 | 86..648 | 98 | <- | Minus |
arm_2R | 7939112..7939196 | 1..85 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:21 Download gff for
AT09538.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12052191..12052753 | 86..648 | 98 | <- | Minus |
2R | 12052806..12052890 | 1..85 | 100 | | Minus |
AT09538.hyp Sequence
Translation from 64 to 507
> AT09538.hyp
MSQENFPLPSVETQAATDEGGPPLPQSPENVEENVKETKEVQESQRCSSS
RILNREHKYKQPECKASRSVKKRKRARIHKRKSTLYGDRAVNCTKCGTVT
IYFPARTKFFSCAEIDGRLFKVKRISSRKVLGGAYRKQPMKRSKLPC*
AT09538.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:59:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30039-PA | 147 | CG30039-PA | 1..147 | 1..147 | 770 | 100 | Plus |
AT09538.pep Sequence
Translation from 64 to 507
> AT09538.pep
MSQENFPLPSVETQAATDEGGPPLPQSPENVEENVKETKEVQESQRCSSS
RILNREHKYKQPECKASRSVKKRKRARIHKRKSTLYGDRAVNCTKCGTVT
IYFPARTKFFSCAEIDGRLFKVKRISSRKVLGGAYRKQPMKRSKLPC*
AT09538.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:43:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22611-PA | 131 | GG22611-PA | 1..125 | 33..147 | 290 | 52.8 | Plus |
Dere\GG16366-PA | 129 | GG16366-PA | 46..123 | 70..147 | 275 | 70.5 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30039-PA | 147 | CG30039-PA | 1..147 | 1..147 | 770 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:43:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20390-PA | 148 | GM20390-PA | 1..148 | 1..147 | 526 | 72.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:43:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25865-PA | 152 | GD25865-PA | 1..152 | 1..147 | 532 | 72.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:43:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13479-PA | 148 | GE13479-PA | 22..140 | 27..142 | 337 | 59.7 | Plus |