Clone AT09538 Report

Search the DGRC for AT09538

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:95
Well:38
Vector:pOTB7
Associated Gene/TranscriptCG30039-RA
Protein status:AT09538.pep: gold
Sequenced Size:678

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8889 2002-01-01 Sim4 clustering to Release 2
CG30039 2002-04-26 Blastp of sequenced clone
CG30039 2003-01-01 Sim4 clustering to Release 3
CG30039 2008-04-29 Release 5.5 accounting
CG30039 2008-08-15 Release 5.9 accounting
CG30039 2008-12-18 5.12 accounting

Clone Sequence Records

AT09538.complete Sequence

678 bp (678 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113224

> AT09538.complete
AACAATCCTTTCTACGAATCACACGTTCTAACGATAAGTCGTAGATGATA
AATATCACAAAACAATGAGCCAAGAAAATTTTCCGCTTCCAAGTGTAGAA
ACACAAGCCGCAACTGATGAAGGAGGTCCTCCATTACCGCAATCACCTGA
AAACGTTGAGGAAAATGTGAAAGAAACCAAAGAGGTTCAAGAGTCCCAGC
GCTGCAGTAGTTCGAGGATTTTAAATCGGGAACATAAATATAAGCAGCCA
GAATGCAAAGCATCGAGATCAGTGAAAAAAAGGAAAAGGGCAAGGATCCA
TAAACGGAAAAGCACTCTCTACGGAGATCGCGCTGTGAACTGTACCAAGT
GCGGAACTGTCACGATCTATTTTCCGGCCCGCACCAAGTTTTTCTCATGT
GCCGAGATAGATGGTCGATTGTTCAAGGTGAAACGGATCTCGTCCAGAAA
AGTACTTGGTGGTGCTTACCGCAAGCAACCTATGAAGCGTTCGAAATTAC
CGTGCTAAAAATTGTTGTCTACGTTTAGGAAACAAAAGTACAAAATTTAC
TTGAAATGAAGTCTTTAGATTTTTACTTGAACGTAATTTTCTAACTAATT
GTATAACTTTTTATCTAAATTATTCGTACTAGTCTTGTCAAATAAAATAA
AATACTGAATAAAAAAAAAAAAAAAAAA

AT09538.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30039-RA 735 CG30039-RA 70..717 1..648 3150 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:17:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7938215..7938778 648..85 2730 98.9 Minus
chr2R 21145070 chr2R 7938830..7938914 85..1 425 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12050992..12051555 648..85 2730 98.9 Minus
2R 25286936 2R 12051607..12051691 85..1 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12052191..12052754 648..85 2730 98.9 Minus
2R 25260384 2R 12052806..12052890 85..1 425 100 Minus
Blast to na_te.dros performed 2019-03-15 15:17:23
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 5489..5563 491..567 119 63.6 Plus
invader2 5124 invader2 INVADER2 5124bp 2400..2441 50..91 111 73.8 Plus

AT09538.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:18:02 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7938215..7938777 86..648 98 <- Minus
chr2R 7938830..7938914 1..85 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:57:46 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 1..444 65..508 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:57:06 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 1..444 65..508 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:22:30 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 1..444 65..508 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:27 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 1..444 65..508 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 1..444 65..508 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:52 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 65..712 1..648 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:57:06 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 65..712 1..648 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:22:30 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 65..712 1..648 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:27 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 65..712 1..648 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
CG30039-RA 65..712 1..648 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12050992..12051554 86..648 98 <- Minus
2R 12051607..12051691 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12050992..12051554 86..648 98 <- Minus
2R 12051607..12051691 1..85 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:18:02 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12050992..12051554 86..648 98 <- Minus
2R 12051607..12051691 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:22:30 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7938497..7939059 86..648 98 <- Minus
arm_2R 7939112..7939196 1..85 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:21 Download gff for AT09538.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12052191..12052753 86..648 98 <- Minus
2R 12052806..12052890 1..85 100   Minus

AT09538.hyp Sequence

Translation from 64 to 507

> AT09538.hyp
MSQENFPLPSVETQAATDEGGPPLPQSPENVEENVKETKEVQESQRCSSS
RILNREHKYKQPECKASRSVKKRKRARIHKRKSTLYGDRAVNCTKCGTVT
IYFPARTKFFSCAEIDGRLFKVKRISSRKVLGGAYRKQPMKRSKLPC*

AT09538.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30039-PA 147 CG30039-PA 1..147 1..147 770 100 Plus

AT09538.pep Sequence

Translation from 64 to 507

> AT09538.pep
MSQENFPLPSVETQAATDEGGPPLPQSPENVEENVKETKEVQESQRCSSS
RILNREHKYKQPECKASRSVKKRKRARIHKRKSTLYGDRAVNCTKCGTVT
IYFPARTKFFSCAEIDGRLFKVKRISSRKVLGGAYRKQPMKRSKLPC*

AT09538.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:43:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22611-PA 131 GG22611-PA 1..125 33..147 290 52.8 Plus
Dere\GG16366-PA 129 GG16366-PA 46..123 70..147 275 70.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30039-PA 147 CG30039-PA 1..147 1..147 770 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20390-PA 148 GM20390-PA 1..148 1..147 526 72.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:43:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25865-PA 152 GD25865-PA 1..152 1..147 532 72.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13479-PA 148 GE13479-PA 22..140 27..142 337 59.7 Plus