Clone AT09746 Report

Search the DGRC for AT09746

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:97
Well:46
Vector:pOTB7
Associated Gene/TranscriptCkIIbeta2-RA
Protein status:AT09746.pep: gold
Sequenced Size:849

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8914 2003-01-01 Sim4 clustering to Release 3
CG8914 2004-01-31 Blastp of sequenced clone
CkIIbeta2 2008-04-29 Release 5.5 accounting
CkIIbeta2 2008-08-15 Release 5.9 accounting
CkIIbeta2 2008-12-18 5.12 accounting

Clone Sequence Records

AT09746.complete Sequence

849 bp (849 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011563

> AT09746.complete
GTTAAGCTCTCGTGATTTTGACTGATTAAATTAAAGCTTAAAAGAAGCAG
CTATGACCGATTCGGACGAATCTTCCTGGATTCATTGGTTTTGCAAGCAG
CGTGGCAACGAATTCTTTTGCGAGGTGGATGAGGAATATATCCAGGACAA
GTTTAACCTTAACTTTCTTGATTCGAACGTTAAGAACTACAAATGTGCCT
TGGAGGTGATCCTGGATCTCAATCCGGGTTCAGCCTCGGAAGACCCCGCT
GAACCAGAACTGGAGGCTAGTGCAGAGAAACTGTATGGCTTGATCCACGC
TCGTTTTATCCTAACCAACCGGGGCATCGAACTGATGTTGGACAAGTACA
ACAAGGGCGAATTCGGGACATGTCCACGTGCATTCTGCCATAGCCAGCCG
GTGCTGCCCATTGGTTTGAGTGATAATCCTGGCGAGGATATGGTACGCAT
CTATTGCCCCAAGTGCAATGATGTGTACATTCCCAAGGCGTCGAGACATT
CGAATCTGGATGGAGCCTTCTTTGGCACTGGATTCCCTCATATGTTCTTT
ATGGAGAAACCGGATGCTAGGCCCAAGCGGGCAAAGCAGAAGTTTGTGCC
CAGGCTTTATGGCTTTAAAATCCACCCCACGGCCTACCGTACTGCCGCTG
AGATCCAAAAAGATGTGACAATGACGCCAGTAGGAGAAATCGATAGCCCA
TCCCACATCTGATCCTAAAGCTAAAATTTCTCATAAGCAACTGTCGCGTA
CTTTTCGAATAAGTGGGCACTGTTCGCCCGGCTGGCTTCCAGCTCATTAA
ACTCTCATAACAATAACTGCTCAGGCTGTGAAAAAAAAAAAAAAAAAAA

AT09746.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
CkIIbeta2-RA 889 CkIIbeta2-RA 53..883 1..831 4020 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16176661..16177264 1..604 3020 100 Plus
chr2R 21145070 chr2R 16177350..16177581 599..830 1160 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20289627..20290230 1..604 2930 99 Plus
2R 25286936 2R 20290319..20290551 599..831 1120 98.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20290826..20291429 1..604 2930 99 Plus
2R 25260384 2R 20291518..20291750 599..831 1120 98.7 Plus
Blast to na_te.dros performed on 2019-03-16 05:22:21 has no hits.

AT09746.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:23:03 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16176661..16177263 1..603 100 -> Plus
chr2R 16177355..16177581 604..830 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:02 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..660 53..712 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:36:50 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..660 53..712 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:42:22 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..660 53..712 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:20:39 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..660 53..712 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:57 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..660 53..712 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:44:13 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..830 1..830 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:36:50 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..830 1..830 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:42:22 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 83..912 1..830 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:20:39 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 1..830 1..830 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:57 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
CkIIbeta2-RA 83..912 1..830 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:03 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20289627..20290229 1..603 99 -> Plus
2R 20290324..20290550 604..830 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:03 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20289627..20290229 1..603 99 -> Plus
2R 20290324..20290550 604..830 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:03 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20289627..20290229 1..603 99 -> Plus
2R 20290324..20290550 604..830 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:42:22 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16177132..16177734 1..603 99 -> Plus
arm_2R 16177829..16178055 604..830 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:57:58 Download gff for AT09746.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20290826..20291428 1..603 99 -> Plus
2R 20291523..20291749 604..830 98   Plus

AT09746.hyp Sequence

Translation from 52 to 711

> AT09746.hyp
MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCAL
EVILDLNPGSASEDPAEPELEASAEKLYGLIHARFILTNRGIELMLDKYN
KGEFGTCPRAFCHSQPVLPIGLSDNPGEDMVRIYCPKCNDVYIPKASRHS
NLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPTAYRTAAE
IQKDVTMTPVGEIDSPSHI*

AT09746.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
CkIIbeta2-PA 219 CG8914-PA 1..219 1..219 1194 100 Plus
CkIIbeta-PH 215 CG15224-PH 1..198 1..196 695 64.1 Plus
CkIIbeta-PG 215 CG15224-PG 1..198 1..196 695 64.1 Plus
CkIIbeta-PD 215 CG15224-PD 1..198 1..196 695 64.1 Plus
CkIIbeta-PC 215 CG15224-PC 1..198 1..196 695 64.1 Plus

AT09746.pep Sequence

Translation from 52 to 711

> AT09746.pep
MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCAL
EVILDLNPGSASEDPAEPELEASAEKLYGLIHARFILTNRGIELMLDKYN
KGEFGTCPRAFCHSQPVLPIGLSDNPGEDMVRIYCPKCNDVYIPKASRHS
NLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPTAYRTAAE
IQKDVTMTPVGEIDSPSHI*

AT09746.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12259-PA 216 GF12259-PA 1..216 1..211 947 80.1 Plus
Dana\GF20435-PA 235 GF20435-PA 1..209 1..207 702 61.2 Plus
Dana\GF11247-PA 245 GF11247-PA 15..200 6..194 521 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22024-PA 219 GG22024-PA 1..218 1..218 1055 86.2 Plus
Dere\GG18445-PA 246 GG18445-PA 12..220 1..207 703 61.2 Plus
Dere\GG19923-PA 236 GG19923-PA 12..193 6..194 483 48.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21823-PA 217 GH21823-PA 1..200 1..200 862 74.5 Plus
Dgri\GH12745-PA 236 GH12745-PA 1..209 1..207 702 61.2 Plus
Dgri\GH22749-PA 247 GH22749-PA 15..206 1..194 447 46.7 Plus
Dgri\GH20876-PA 335 GH20876-PA 1..183 1..184 432 46.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
CkIIbeta2-PA 219 CG8914-PA 1..219 1..219 1194 100 Plus
CkIIbeta-PH 215 CG15224-PH 1..198 1..196 695 64.1 Plus
CkIIbeta-PG 215 CG15224-PG 1..198 1..196 695 64.1 Plus
CkIIbeta-PD 215 CG15224-PD 1..198 1..196 695 64.1 Plus
CkIIbeta-PC 215 CG15224-PC 1..198 1..196 695 64.1 Plus
CkIIbeta-PF 215 CG15224-PF 1..198 1..196 695 64.1 Plus
CkIIbeta-PB 215 CG15224-PB 1..198 1..196 695 64.1 Plus
CkIIbeta-PJ 233 CG15224-PJ 1..198 1..196 695 64.1 Plus
CkIIbeta-PI 233 CG15224-PI 1..198 1..196 695 64.1 Plus
CkIIbeta-PK 234 CG15224-PK 1..198 1..196 695 64.1 Plus
CkIIbeta-PE 235 CG15224-PE 1..198 1..196 695 64.1 Plus
Ssl-PA 219 CG13591-PA 11..188 6..194 469 49.7 Plus
SteXh:CG42398-PA 172 CG42398-PA 4..164 2..173 329 39.5 Plus
Ste:CG33238-PB 172 CG33238-PB 5..162 3..171 321 38.5 Plus
Ste:CG33246-PB 172 CG33246-PB 4..162 2..171 320 38.2 Plus
Ste:CG33243-PB 172 CG33243-PB 4..162 2..171 320 38.2 Plus
Ste:CG33241-PB 172 CG33241-PB 4..162 2..171 318 38.2 Plus
Ste:CG33239-PB 172 CG33239-PB 4..162 2..171 318 38.2 Plus
Ste:CG33245-PB 172 CG33245-PB 4..162 2..171 317 38.2 Plus
Ste:CG33244-PB 172 CG33244-PB 4..162 2..171 317 38.2 Plus
Ste:CG33240-PB 172 CG33240-PB 4..162 2..171 317 38.2 Plus
Ste:CG33237-PB 172 CG33237-PB 4..162 2..171 317 38.2 Plus
Ste:CG33236-PB 172 CG33236-PB 4..162 2..171 317 38.2 Plus
Ste:CG33247-PB 172 CG33247-PB 4..162 2..171 316 38.2 Plus
Ste12DOR-PB 172 CG32616-PB 4..162 2..171 315 37.6 Plus
Ste:CG33242-PB 171 CG33242-PB 18..161 17..171 261 36.8 Plus
CG40635-PB 88 CG40635-PB 12..88 6..91 145 39.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20794-PA 216 GI20794-PA 1..200 1..200 844 75 Plus
Dmoj\GI15890-PA 236 GI15890-PA 1..209 1..207 702 61.2 Plus
Dmoj\GI18532-PA 265 GI18532-PA 6..211 2..208 497 48.8 Plus
Dmoj\GI20990-PA 248 GI20990-PA 5..215 6..204 493 46 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:19:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17632-PA 211 GL17632-PA 1..206 1..205 866 73.8 Plus
Dper\GL19762-PA 208 GL19762-PA 1..206 1..206 820 70.9 Plus
Dper\GL20424-PA 205 GL20424-PA 3..188 6..194 466 47.1 Plus
Dper\GL20197-PA 242 GL20197-PA 1..125 1..123 412 60 Plus
Dper\GL14174-PA 136 GL14174-PA 7..123 15..174 217 39.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21406-PA 211 GA21406-PA 1..206 1..205 866 73.8 Plus
Dpse\GA27055-PA 208 GA27055-PA 1..206 1..206 827 71.4 Plus
Dpse\GA25112-PA 205 GA25112-PA 3..188 6..194 471 47.6 Plus
Dpse\GA22384-PA 121 GA22384-PA 2..108 25..174 189 38 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\CkIIbeta2-PA 219 GM22006-PA 1..219 1..219 1121 94.1 Plus
Dsec\GM13109-PA 246 GM13109-PA 12..220 1..207 703 61.2 Plus
Dsec\GM17556-PA 226 GM17556-PA 13..195 7..199 472 46.6 Plus
Dsec\GM17552-PA 226 GM17552-PA 13..195 7..199 472 46.6 Plus
Dsec\GM11826-PA 219 GM11826-PA 10..188 5..194 449 47.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:19:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\CkIIbeta2-PA 219 GD11505-PA 1..219 1..219 1121 94.1 Plus
Dsim\GD17050-PA 246 GD17050-PA 12..220 1..207 703 61.2 Plus
Dsim\GD15860-PA 194 GD15860-PA 12..191 6..196 462 46.1 Plus
Dsim\GD24508-PA 223 GD24508-PA 13..192 7..196 460 47.4 Plus
Dsim\GD20851-PA 194 GD20851-PA 12..191 6..196 453 44.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:19:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20529-PA 212 GJ20529-PA 1..211 1..215 875 74 Plus
Dvir\GJ16637-PA 236 GJ16637-PA 1..209 1..207 702 61.2 Plus
Dvir\GJ21399-PA 241 GJ21399-PA 3..204 6..209 482 46.2 Plus
Dvir\GJ20708-PA 296 GJ20708-PA 5..182 6..184 465 50.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19625-PA 212 GK19625-PA 1..200 1..200 937 84 Plus
Dwil\GK14838-PA 238 GK14838-PA 1..209 1..207 702 61.2 Plus
Dwil\GK19682-PA 244 GK19682-PA 17..208 6..194 477 47.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12102-PA 217 GE12102-PA 1..216 1..218 1058 88.5 Plus
Dyak\GE15667-PA 246 GE15667-PA 12..220 1..207 703 61.2 Plus
Dyak\GE11447-PA 236 GE11447-PA 12..193 6..194 472 46.6 Plus