Clone AT09839 Report

Search the DGRC for AT09839

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:98
Well:39
Vector:pOTB7
Associated Gene/Transcript14-3-3epsilon-RC
Protein status:AT09839.pep: gold
Sequenced Size:1089

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
14-3-3epsilon-rc 2010-01-13 Manual selection by Sue Celniker

Clone Sequence Records

AT09839.complete Sequence

1089 bp assembled on 2010-02-11

GenBank Submission: BT120310.1

> AT09839.complete
TTCAACACAATGACTGAGCGCGAGAACAATGTGTACAAGGCAAAGCTGGC
CGAACAGGCCGAGCGCTACGACGAAATGGTGGAGGCCATGAAGAAGGTCG
CCTCCATGGACGTAGAGCTGACCGTCGAGGAGCGAAATCTGCTGTCGGTG
GCGTACAAGAATGTGATTGGAGCACGCCGTGCCTCGTGGCGCATCATCAC
CTCGATCGAACAGAAGGAGGAGAACAAGGGGGCCGAGGAGAAATTGGAGA
TGATCAAAACCTATCGCGGACAGGTGGAGAAGGAGCTGCGCGACATCTGC
TCGGATATACTGAACGTGCTCGAGAAGCATCTCATTCCATGCGCCACATC
CGGCGAAAGCAAAGTATTCTACTATAAGATGAAGGGCGACTACCATCGCT
ACCTGGCCGAATTCGCCACCGGCTCCGACCGCAAGGATGCGGCAGAGAAC
TCGCTGATTGCCTACAAGGCGGCCAGCGATATTGCCATGAACGATCTGCC
ACCAACACACCCCATCCGTTTGGGCTTGGCATTGAACTTCTCGGTGTTCT
ACTATGAGATTCTCAACTCGCCGGACCGCGCTTGCCGCTTGGCGAAAGCC
GCTTTCGATGATGCCATTGCCGAGTTGGATACACTGAGCGAAGAGAGCTA
CAAAGACTCGACACTCATCATGCAGCTGCTGCGCGACAACCTCACATTAT
GGACGTCCGATATGCAGGCAGAAGGTGATGGCGAGCCCAAAGAGCAAATC
CAGGATGTTGAGGATCAGGACGTGTCGTAATTTAAGTAAACCCCCGCCCT
TCCATTTAAAACACATTATATACCTTCTAAAGTAAATATAATACCATATA
ATATATATGCATACAACAACAACAACAAAATCAACAACAACACGACAACA
ACTTCAAGAACAACAACATGGAACCAATGCGGCAACAACAACCATAGCAG
TCGATCACCACAACAGCAGCACCCGTATGTGTATCAACATATTTGCAACA
TGATAACAGCAAGCAAAGCAGCAGGAACACAAATTGTCATCCACAATAAA
CAGCATGGAAAACAACAGCACAAAAAAAAAAAAAAAAAA

AT09839.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon.bc 3629 14-3-3epsilon.bc 475..1198 1..724 3605 99.8 Plus
14-3-3epsilon.ag 3419 14-3-3epsilon.ag 337..1060 1..724 3605 99.8 Plus
14-3-3epsilon.ay 3477 14-3-3epsilon.ay 475..1198 1..724 3605 99.8 Plus
14-3-3epsilon.bc 3629 14-3-3epsilon.bc 1215..1581 723..1089 1805 99.4 Plus
14-3-3epsilon.ag 3419 14-3-3epsilon.ag 1077..1443 723..1089 1805 99.4 Plus
14-3-3epsilon.ay 3477 14-3-3epsilon.ay 1215..1581 723..1089 1805 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14071726..14072199 73..546 2355 99.8 Plus
chr3R 27901430 chr3R 14072525..14072873 723..1071 1745 100 Plus
chr3R 27901430 chr3R 14072264..14072447 543..726 920 100 Plus
chr3R 27901430 chr3R 14067131..14067203 1..73 365 100 Plus
chr2R 21145070 chr2R 5995017..5995123 604..710 280 84.1 Plus
chr2R 21145070 chr2R 5993556..5993651 502..597 195 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18247432..18247905 73..546 2355 99.8 Plus
3R 32079331 3R 18248231..18248597 723..1089 1805 99.5 Plus
3R 32079331 3R 18247970..18248153 543..726 920 100 Plus
3R 32079331 3R 18242837..18242909 1..73 365 100 Plus
2R 25286936 2R 10107470..10107576 604..710 280 84.1 Plus
2R 25286936 2R 10106006..10106101 502..597 210 81.2 Plus
2R 25286936 2R 10106354..10106449 502..597 210 81.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17988263..17988736 73..546 2355 99.7 Plus
3R 31820162 3R 17989062..17989428 723..1089 1805 99.4 Plus
3R 31820162 3R 17988801..17988984 543..726 920 100 Plus
3R 31820162 3R 17983668..17983740 1..73 365 100 Plus
2R 25260384 2R 10108669..10108775 604..710 280 84.1 Plus
2R 25260384 2R 10107553..10107648 502..597 210 81.2 Plus
2R 25260384 2R 10107205..10107300 502..597 210 81.2 Plus
Blast to na_te.dros performed on 2019-03-16 09:47:25 has no hits.

AT09839.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:48:31 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14072721..14072873 919..1071 100   Plus
chr3R 14067131..14067203 1..73 100 -> Plus
chr3R 14071727..14072196 74..543 99 -> Plus
chr3R 14072265..14072445 544..724 100 -> Plus
chr3R 14072527..14072664 725..862 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-11 10:06:09 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RD 1..783 10..780 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:23:21 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RD 1..783 10..780 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:06:44 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RC 1..771 10..780 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:48 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RC 1..771 10..780 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-11 10:06:09 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RD 307..1389 1..1071 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:23:21 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RD 307..1389 1..1071 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:44 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RC 151..1221 1..1071 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:48 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3epsilon-RC 151..1221 1..1071 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:31 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18242837..18242909 1..73 100 -> Plus
3R 18247433..18247902 74..543 99 -> Plus
3R 18247971..18248151 544..724 100 -> Plus
3R 18248233..18248579 725..1071 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:31 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18242837..18242909 1..73 100 -> Plus
3R 18247433..18247902 74..543 99 -> Plus
3R 18247971..18248151 544..724 100 -> Plus
3R 18248233..18248579 725..1071 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:31 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18242837..18242909 1..73 100 -> Plus
3R 18247433..18247902 74..543 99 -> Plus
3R 18247971..18248151 544..724 100 -> Plus
3R 18248233..18248579 725..1071 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:44 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14068559..14068631 1..73 100 -> Plus
arm_3R 14073155..14073624 74..543 99 -> Plus
arm_3R 14073693..14073873 544..724 100 -> Plus
arm_3R 14073955..14074301 725..1071 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:10:55 Download gff for AT09839.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17988264..17988733 74..543 99 -> Plus
3R 17988802..17988982 544..724 100 -> Plus
3R 17989064..17989410 725..1071 100   Plus
3R 17983668..17983740 1..73 100 -> Plus

AT09839.hyp Sequence

Translation from 0 to 779

> AT09839.hyp
FNTMTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSV
AYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDIC
SDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAEN
SLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA
AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEGDGEPKEQI
QDVEDQDVS*

AT09839.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon-PC 256 CG31196-PC 1..256 4..259 1299 100 Plus
14-3-3epsilon-PD 260 CG31196-PD 1..260 4..259 1284 98.5 Plus
14-3-3epsilon-PB 261 CG31196-PB 1..261 4..259 1283 98.1 Plus
14-3-3epsilon-PA 262 CG31196-PA 1..262 4..259 1282 97.7 Plus
14-3-3zeta-PI 248 CG17870-PI 5..244 6..248 818 67.1 Plus

AT09839.pep Sequence

Translation from 0 to 779

> AT09839.pep
FNTMTERENNVYKAKLAEQAERYDEMVEAMKKVASMDVELTVEERNLLSV
AYKNVIGARRASWRIITSIEQKEENKGAEEKLEMIKTYRGQVEKELRDIC
SDILNVLEKHLIPCATSGESKVFYYKMKGDYHRYLAEFATGSDRKDAAEN
SLIAYKAASDIAMNDLPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKA
AFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQAEGDGEPKEQI
QDVEDQDVS*

AT09839.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23073-PA 263 GF23073-PA 1..263 4..259 1286 94.3 Plus
Dana\GF12019-PA 248 GF12019-PA 2..244 3..248 855 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:23:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22781-PA 262 GG22781-PA 1..262 4..259 1339 97.7 Plus
Dere\GG24140-PA 248 GG24140-PA 2..244 3..248 843 65.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18560-PA 260 GH18560-PA 1..260 4..259 1333 97.3 Plus
Dgri\GH21250-PA 248 GH21250-PA 2..244 3..248 855 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3epsilon-PC 256 CG31196-PC 1..256 4..259 1299 100 Plus
14-3-3epsilon-PD 260 CG31196-PD 1..260 4..259 1284 98.5 Plus
14-3-3epsilon-PB 261 CG31196-PB 1..261 4..259 1283 98.1 Plus
14-3-3epsilon-PA 262 CG31196-PA 1..262 4..259 1282 97.7 Plus
14-3-3zeta-PI 248 CG17870-PI 5..244 6..248 818 67.1 Plus
14-3-3zeta-PA 248 CG17870-PA 5..244 6..248 818 67.1 Plus
14-3-3zeta-PG 248 CG17870-PG 5..244 6..248 818 67.1 Plus
14-3-3zeta-PH 248 CG17870-PH 5..244 6..248 818 67.1 Plus
14-3-3zeta-PB 248 CG17870-PB 5..244 6..248 818 67.1 Plus
14-3-3zeta-PL 248 CG17870-PL 5..244 6..248 816 66.7 Plus
14-3-3zeta-PK 248 CG17870-PK 5..244 6..248 816 66.7 Plus
14-3-3zeta-PJ 248 CG17870-PJ 5..244 6..248 816 66.7 Plus
14-3-3zeta-PE 248 CG17870-PE 5..244 6..248 816 66.7 Plus
14-3-3zeta-PD 248 CG17870-PD 5..244 6..248 816 66.7 Plus
14-3-3zeta-PC 248 CG17870-PC 5..244 6..248 813 67.1 Plus
14-3-3zeta-PF 248 CG17870-PF 5..244 6..248 813 67.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24759-PA 260 GI24759-PA 1..260 4..259 1333 97.3 Plus
Dmoj\GI20537-PA 248 GI20537-PA 2..244 3..248 855 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:23:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21790-PA 262 GL21790-PA 1..262 4..259 1339 97.7 Plus
Dper\GL17609-PA 248 GL17609-PA 2..244 3..248 855 66.7 Plus
Dper\GL25387-PA 250 GL25387-PA 1..249 4..249 728 56.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16084-PA 262 GA16084-PA 1..262 4..259 1339 97.7 Plus
Dpse\GA24843-PA 248 GA24843-PA 2..244 3..248 855 66.7 Plus
Dpse\GA22759-PA 250 GA22759-PA 1..249 4..249 735 56.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:23:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15292-PA 262 GM15292-PA 1..262 4..259 1339 97.7 Plus
Dsec\GM21186-PA 248 GM21186-PA 2..244 3..248 843 65.9 Plus
Dsec\GM12998-PA 138 GM12998-PA 55..134 168..248 371 84 Plus
Dsec\GM12998-PA 138 GM12998-PA 5..54 6..55 155 62 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:23:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15169-PA 240 GD15169-PA 1..240 26..259 1228 97.5 Plus
Dsim\GD12271-PA 248 GD12271-PA 2..244 3..248 836 65.4 Plus
Dsim\GD24394-PA 51 GD24394-PA 2..49 187..234 217 83.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22546-PA 260 GJ22546-PA 1..260 4..259 1333 97.3 Plus
Dvir\GJ22386-PA 248 GJ22386-PA 2..244 3..248 854 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22388-PA 260 GK22388-PA 1..260 4..259 1329 97.7 Plus
Dwil\GK21486-PA 248 GK21486-PA 2..244 3..248 855 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25525-PA 256 GE25525-PA 1..256 4..259 1359 100 Plus
Dyak\14-3-3zeta-PA 248 GE19338-PA 2..244 3..248 843 65.9 Plus