Clone AT09846 Report

Search the DGRC for AT09846

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:98
Well:46
Vector:pOTB7
Associated Gene/TranscriptCG34178-RA
Protein status:AT09846.pep2: gold AT09846.pep: gold
Preliminary Size:378
Sequenced Size:903

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12677 2002-01-01 Sim4 clustering to Release 2
CG12677 2002-04-21 Blastp of sequenced clone
CG12677 2003-01-01 Sim4 clustering to Release 3
CG34178 2008-04-29 Release 5.5 accounting
CG34178 2008-08-15 Release 5.9 accounting
CG34177 2008-08-15 Release 5.9 accounting
CG34178 2008-12-18 5.12 accounting
CG34177 2008-12-18 5.12 accounting

Clone Sequence Records

AT09846.complete Sequence

903 bp (903 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113225.1

> AT09846.complete
TAAATACAACAATTTAGCTTTATAAACTTCGCCACACATTTCTGAAGAGG
CGATGGCCGCGCGGACTAGTGTCCTTTTGGCTATGCTCCTATGGATCCTT
TTCGCCGCGGTCCAGTCGGCGGAATGGGAGGACATTCACTACGACCCGAA
CCATCCTGGTAAGTGCACCATCAACCCGGGACTCGTCCTCAATCCGGGGG
TTAGCATCAAGGATCCCACGCACGAGTGCCGCAAAATCTTGTGTGGCCTC
AATGGACGTGTCGTTTACCACAGCTGCGGAGTTAGCATCCTGTCGCCTCC
TTGCCGCTACGGTGACTACATCAATCCGGATCTTCCCTATCCTGACTGCT
GCAGCAGGACCCTACTTTGCAACTAGGCAGGCCGATCGTTCGTTGTCAAT
TGGATGTACAATAGTTTATATTTATATCGAAATCTGTGCAAAATGTCGTT
TGTTCCAGAGACTTTTATTATTTATGGCTTTTTATGGAGCTTGGTGGTTT
TCCCAGCTTTCGCTAATTTTTCCCTCTACAACTACGGGGATTCAGCCTAT
CCCAATTGCTGTGTTCTCGATATTGACTCAACGCGGATACTGCTTAAAAT
GGGTCAGAAATTTCGCCCAAAATTCCTGCCCTGCACGACAATTTTATGCA
TTGGCGATGGATATGGAATGCTGTTTACGTGTGATAAAAAGGAACCACCA
GAGCACTGTCACTTTAAGGATTATTTGAATGGGGATGCCAATTATCCAGA
TTGTTGCTACCGCAAACTTGAGTGCGACTGAAATTTCTAGTTACATAATG
TGTTTAAATTTAGGTGAAAGTGAATTTTTCAAAACTAACCAACCAGCTAA
AATAAAGTTTTGAATAAATCAATTTTACACACAAAAAAAAAAAAAAAAAA
AAA

AT09846.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34177-RA 882 CG34177-RA 1..882 1..882 4410 100 Plus
CG34178-RA 882 CG34178-RA 1..882 1..882 4410 100 Plus
CG34178-RB 940 CG34178-RB 208..940 150..882 3665 100 Plus
CG34178-RB 940 CG34178-RB 1..149 1..149 745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4433456..4433730 271..545 1375 100 Plus
chr2L 23010047 chr2L 4434016..4434219 679..882 975 98.5 Plus
chr2L 23010047 chr2L 4433069..4433217 1..149 745 100 Plus
chr2L 23010047 chr2L 4433777..4433916 541..680 700 100 Plus
chr2L 23010047 chr2L 4433276..4433399 150..273 620 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4434295..4434569 271..545 1375 100 Plus
2L 23513712 2L 4434854..4435060 679..885 1035 100 Plus
2L 23513712 2L 4433908..4434056 1..149 745 100 Plus
2L 23513712 2L 4434616..4434755 541..680 700 100 Plus
2L 23513712 2L 4434115..4434238 150..273 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4434295..4434569 271..545 1375 100 Plus
2L 23513712 2L 4434854..4435060 679..885 1035 100 Plus
2L 23513712 2L 4433908..4434056 1..149 745 100 Plus
2L 23513712 2L 4434616..4434755 541..680 700 100 Plus
2L 23513712 2L 4434115..4434238 150..273 620 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:03:04 has no hits.

AT09846.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:56 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4433276..4433399 150..273 100 -> Plus
chr2L 4433069..4433217 1..149 100 -> Plus
chr2L 4433459..4433730 274..545 100 -> Plus
chr2L 4433782..4433914 546..678 100 -> Plus
chr2L 4434016..4434219 679..882 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:17 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RC 1..339 443..781 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:01:37 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RB 1..339 443..781 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:40:29 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..339 443..781 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:54:58 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RC 1..339 443..781 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:45 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..339 443..781 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:43:02 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:01:37 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:40:29 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:54:58 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34178-RA 1..882 1..882 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:45 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
CG34177-RA 1..882 1..882 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4434298..4434569 274..545 100 -> Plus
2L 4434621..4434753 546..678 100 -> Plus
2L 4434854..4435057 679..882 100   Plus
2L 4434115..4434238 150..273 100 -> Plus
2L 4433908..4434056 1..149 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4434298..4434569 274..545 100 -> Plus
2L 4434621..4434753 546..678 100 -> Plus
2L 4434854..4435057 679..882 100   Plus
2L 4434115..4434238 150..273 100 -> Plus
2L 4433908..4434056 1..149 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4434298..4434569 274..545 100 -> Plus
2L 4434621..4434753 546..678 100 -> Plus
2L 4434854..4435057 679..882 100   Plus
2L 4434115..4434238 150..273 100 -> Plus
2L 4433908..4434056 1..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:40:29 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4434621..4434753 546..678 100 -> Plus
arm_2L 4434854..4435057 679..882 100   Plus
arm_2L 4433908..4434056 1..149 100 -> Plus
arm_2L 4434115..4434238 150..273 100 -> Plus
arm_2L 4434298..4434569 274..545 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:27:11 Download gff for AT09846.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4434298..4434569 274..545 100 -> Plus
2L 4434621..4434753 546..678 100 -> Plus
2L 4434854..4435057 679..882 100   Plus
2L 4433908..4434056 1..149 100 -> Plus
2L 4434115..4434238 150..273 100 -> Plus

AT09846.pep2 Sequence

Translation from 52 to 375

> AT09846.pep2
MAARTSVLLAMLLWILFAAVQSAEWEDIHYDPNHPGKCTINPGLVLNPGV
SIKDPTHECRKILCGLNGRVVYHSCGVSILSPPCRYGDYINPDLPYPDCC
SRTLLCN*

AT09846.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21200-PA 107 GF21200-PA 19..107 19..107 350 66.3 Plus
Dana\GF21439-PA 114 GF21439-PA 5..111 7..107 150 30.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25002-PA 107 GG25002-PA 1..107 1..107 496 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10126-PA 193 GH10126-PA 29..114 15..99 252 53.5 Plus
Dgri\GH24561-PA 114 GH24561-PA 7..110 6..106 168 33 Plus
Dgri\GH10127-PA 109 GH10127-PA 24..107 18..106 165 38.2 Plus
Dgri\GH11662-PA 111 GH11662-PA 2..104 4..106 152 38.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34177-PA 107 CG34177-PA 1..107 1..107 601 100 Plus
CG34215-PA 104 CG34215-PA 4..102 5..105 203 39.6 Plus
CG2444-PB 114 CG2444-PB 37..111 33..107 136 30.7 Plus
CG2444-PA 114 CG2444-PA 37..111 33..107 136 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22106-PA 175 GI22106-PA 93..167 33..107 247 57.3 Plus
Dmoj\GI22128-PA 112 GI22128-PA 24..109 20..105 156 32.6 Plus
Dmoj\GI16321-PA 114 GI16321-PA 8..111 6..107 148 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15154-PA 187 GL15154-PA 7..74 6..73 217 57.4 Plus
Dper\GL15427-PA 106 GL15427-PA 8..104 7..105 188 38.4 Plus
Dper\GL15237-PA 112 GL15237-PA 7..108 6..106 147 28.4 Plus
Dper\GL15154-PA 187 GL15154-PA 78..187 1..107 145 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25544-PA 187 GA25544-PA 1..74 1..73 217 58.1 Plus
Dpse\GA26063-PA 106 GA26063-PA 8..104 7..105 188 38.4 Plus
Dpse\GA15367-PA 112 GA15367-PA 6..108 5..106 147 28.2 Plus
Dpse\GA25544-PA 187 GA25544-PA 78..187 1..107 142 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19985-PA 110 GJ19985-PA 22..110 20..107 247 50.6 Plus
Dvir\GJ19996-PA 111 GJ19996-PA 23..109 20..106 195 42.5 Plus
Dvir\GJ15661-PA 122 GJ15661-PA 22..119 10..107 158 28.6 Plus
Dvir\GJ17737-PA 111 GJ17737-PA 1..104 1..106 140 31.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24349-PA 105 GK24349-PA 18..104 20..106 278 56.3 Plus
Dwil\GK19793-PA 115 GK19793-PA 9..112 7..107 157 29.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18289-PA 83 GE18289-PA 1..63 11..73 312 90.5 Plus
Dyak\GE17607-PA 115 GE17607-PA 39..111 34..106 131 31.5 Plus

AT09846.hyp Sequence

Translation from 251 to 727

> AT09846.hyp
MDVSFTTAAELASCRLLAATVTTSIRIFPILTAAAGPYFATRQADRSLSI
GCTIVYIYIEICAKCRLFQRLLLFMAFYGAWWFSQLSLIFPSTTTGIQPI
PIAVFSILTQRGYCLKWVRNFAQNSCPARQFYALAMDMECCLRVIKRNHQ
STVTLRII*
Sequence AT09846.hyp has no blast hits.

AT09846.pep Sequence

Translation from 403 to 780

> AT09846.pep
MYNSLYLYRNLCKMSFVPETFIIYGFLWSLVVFPAFANFSLYNYGDSAYP
NCCVLDIDSTRILLKMGQKFRPKFLPCTTILCIGDGYGMLFTCDKKEPPE
HCHFKDYLNGDANYPDCCYRKLECD*

AT09846.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21439-PA 114 GF21439-PA 38..111 49..125 136 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18842-PA 113 GG18842-PA 4..110 16..125 141 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10126-PA 193 GH10126-PA 95..191 33..124 166 36.1 Plus
Dgri\GH24561-PA 114 GH24561-PA 24..110 35..124 144 28.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34178-PC 112 CG34178-PC 1..112 14..125 641 100 Plus
CG34178-PB 112 CG34178-PB 1..112 14..125 641 100 Plus
CG34178-PA 112 CG34178-PA 1..112 14..125 641 100 Plus
CG2444-PB 114 CG2444-PB 10..111 21..125 146 32.4 Plus
CG2444-PA 114 CG2444-PA 10..111 21..125 146 32.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22117-PA 109 GI22117-PA 16..108 32..124 226 44.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15154-PA 187 GL15154-PA 75..187 13..125 246 39.8 Plus
Dper\GL15237-PA 112 GL15237-PA 1..108 14..124 145 28.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25544-PA 187 GA25544-PA 75..187 13..125 235 38.9 Plus
Dpse\GA15367-PA 112 GA15367-PA 1..108 14..124 146 28.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13054-PA 114 GM13054-PA 27..111 35..125 133 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15980-PA 114 GD15980-PA 27..111 35..125 141 38.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15661-PA 122 GJ15661-PA 4..118 5..124 144 26.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19793-PA 115 GK19793-PA 18..112 23..125 139 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17607-PA 115 GE17607-PA 25..112 35..125 140 35.2 Plus