Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT09846.complete Sequence
903 bp (903 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113225.1
> AT09846.complete
TAAATACAACAATTTAGCTTTATAAACTTCGCCACACATTTCTGAAGAGG
CGATGGCCGCGCGGACTAGTGTCCTTTTGGCTATGCTCCTATGGATCCTT
TTCGCCGCGGTCCAGTCGGCGGAATGGGAGGACATTCACTACGACCCGAA
CCATCCTGGTAAGTGCACCATCAACCCGGGACTCGTCCTCAATCCGGGGG
TTAGCATCAAGGATCCCACGCACGAGTGCCGCAAAATCTTGTGTGGCCTC
AATGGACGTGTCGTTTACCACAGCTGCGGAGTTAGCATCCTGTCGCCTCC
TTGCCGCTACGGTGACTACATCAATCCGGATCTTCCCTATCCTGACTGCT
GCAGCAGGACCCTACTTTGCAACTAGGCAGGCCGATCGTTCGTTGTCAAT
TGGATGTACAATAGTTTATATTTATATCGAAATCTGTGCAAAATGTCGTT
TGTTCCAGAGACTTTTATTATTTATGGCTTTTTATGGAGCTTGGTGGTTT
TCCCAGCTTTCGCTAATTTTTCCCTCTACAACTACGGGGATTCAGCCTAT
CCCAATTGCTGTGTTCTCGATATTGACTCAACGCGGATACTGCTTAAAAT
GGGTCAGAAATTTCGCCCAAAATTCCTGCCCTGCACGACAATTTTATGCA
TTGGCGATGGATATGGAATGCTGTTTACGTGTGATAAAAAGGAACCACCA
GAGCACTGTCACTTTAAGGATTATTTGAATGGGGATGCCAATTATCCAGA
TTGTTGCTACCGCAAACTTGAGTGCGACTGAAATTTCTAGTTACATAATG
TGTTTAAATTTAGGTGAAAGTGAATTTTTCAAAACTAACCAACCAGCTAA
AATAAAGTTTTGAATAAATCAATTTTACACACAAAAAAAAAAAAAAAAAA
AAA
AT09846.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:15:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34177-RA | 882 | CG34177-RA | 1..882 | 1..882 | 4410 | 100 | Plus |
CG34178-RA | 882 | CG34178-RA | 1..882 | 1..882 | 4410 | 100 | Plus |
CG34178-RB | 940 | CG34178-RB | 208..940 | 150..882 | 3665 | 100 | Plus |
CG34178-RB | 940 | CG34178-RB | 1..149 | 1..149 | 745 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:03:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 4433456..4433730 | 271..545 | 1375 | 100 | Plus |
chr2L | 23010047 | chr2L | 4434016..4434219 | 679..882 | 975 | 98.5 | Plus |
chr2L | 23010047 | chr2L | 4433069..4433217 | 1..149 | 745 | 100 | Plus |
chr2L | 23010047 | chr2L | 4433777..4433916 | 541..680 | 700 | 100 | Plus |
chr2L | 23010047 | chr2L | 4433276..4433399 | 150..273 | 620 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4434295..4434569 | 271..545 | 1375 | 100 | Plus |
2L | 23513712 | 2L | 4434854..4435060 | 679..885 | 1035 | 100 | Plus |
2L | 23513712 | 2L | 4433908..4434056 | 1..149 | 745 | 100 | Plus |
2L | 23513712 | 2L | 4434616..4434755 | 541..680 | 700 | 100 | Plus |
2L | 23513712 | 2L | 4434115..4434238 | 150..273 | 620 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4434295..4434569 | 271..545 | 1375 | 100 | Plus |
2L | 23513712 | 2L | 4434854..4435060 | 679..885 | 1035 | 100 | Plus |
2L | 23513712 | 2L | 4433908..4434056 | 1..149 | 745 | 100 | Plus |
2L | 23513712 | 2L | 4434616..4434755 | 541..680 | 700 | 100 | Plus |
2L | 23513712 | 2L | 4434115..4434238 | 150..273 | 620 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 19:03:04 has no hits.
AT09846.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:03:56 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 4433276..4433399 | 150..273 | 100 | -> | Plus |
chr2L | 4433069..4433217 | 1..149 | 100 | -> | Plus |
chr2L | 4433459..4433730 | 274..545 | 100 | -> | Plus |
chr2L | 4433782..4433914 | 546..678 | 100 | -> | Plus |
chr2L | 4434016..4434219 | 679..882 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:17 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RC | 1..339 | 443..781 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:01:37 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RB | 1..339 | 443..781 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:40:29 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..339 | 443..781 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:54:58 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RC | 1..339 | 443..781 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:45 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..339 | 443..781 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:43:02 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..882 | 1..882 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:01:37 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..882 | 1..882 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:40:29 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..882 | 1..882 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:54:58 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34178-RA | 1..882 | 1..882 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:45 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34177-RA | 1..882 | 1..882 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4434298..4434569 | 274..545 | 100 | -> | Plus |
2L | 4434621..4434753 | 546..678 | 100 | -> | Plus |
2L | 4434854..4435057 | 679..882 | 100 | | Plus |
2L | 4434115..4434238 | 150..273 | 100 | -> | Plus |
2L | 4433908..4434056 | 1..149 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4434298..4434569 | 274..545 | 100 | -> | Plus |
2L | 4434621..4434753 | 546..678 | 100 | -> | Plus |
2L | 4434854..4435057 | 679..882 | 100 | | Plus |
2L | 4434115..4434238 | 150..273 | 100 | -> | Plus |
2L | 4433908..4434056 | 1..149 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:03:56 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4434298..4434569 | 274..545 | 100 | -> | Plus |
2L | 4434621..4434753 | 546..678 | 100 | -> | Plus |
2L | 4434854..4435057 | 679..882 | 100 | | Plus |
2L | 4434115..4434238 | 150..273 | 100 | -> | Plus |
2L | 4433908..4434056 | 1..149 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:40:29 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4434621..4434753 | 546..678 | 100 | -> | Plus |
arm_2L | 4434854..4435057 | 679..882 | 100 | | Plus |
arm_2L | 4433908..4434056 | 1..149 | 100 | -> | Plus |
arm_2L | 4434115..4434238 | 150..273 | 100 | -> | Plus |
arm_2L | 4434298..4434569 | 274..545 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:27:11 Download gff for
AT09846.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4434298..4434569 | 274..545 | 100 | -> | Plus |
2L | 4434621..4434753 | 546..678 | 100 | -> | Plus |
2L | 4434854..4435057 | 679..882 | 100 | | Plus |
2L | 4433908..4434056 | 1..149 | 100 | -> | Plus |
2L | 4434115..4434238 | 150..273 | 100 | -> | Plus |
AT09846.pep2 Sequence
Translation from 52 to 375
> AT09846.pep2
MAARTSVLLAMLLWILFAAVQSAEWEDIHYDPNHPGKCTINPGLVLNPGV
SIKDPTHECRKILCGLNGRVVYHSCGVSILSPPCRYGDYINPDLPYPDCC
SRTLLCN*
AT09846.pep2 Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:17:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21200-PA | 107 | GF21200-PA | 19..107 | 19..107 | 350 | 66.3 | Plus |
Dana\GF21439-PA | 114 | GF21439-PA | 5..111 | 7..107 | 150 | 30.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:17:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25002-PA | 107 | GG25002-PA | 1..107 | 1..107 | 496 | 87.9 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:17:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10126-PA | 193 | GH10126-PA | 29..114 | 15..99 | 252 | 53.5 | Plus |
Dgri\GH24561-PA | 114 | GH24561-PA | 7..110 | 6..106 | 168 | 33 | Plus |
Dgri\GH10127-PA | 109 | GH10127-PA | 24..107 | 18..106 | 165 | 38.2 | Plus |
Dgri\GH11662-PA | 111 | GH11662-PA | 2..104 | 4..106 | 152 | 38.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34177-PA | 107 | CG34177-PA | 1..107 | 1..107 | 601 | 100 | Plus |
CG34215-PA | 104 | CG34215-PA | 4..102 | 5..105 | 203 | 39.6 | Plus |
CG2444-PB | 114 | CG2444-PB | 37..111 | 33..107 | 136 | 30.7 | Plus |
CG2444-PA | 114 | CG2444-PA | 37..111 | 33..107 | 136 | 30.7 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:17:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI22106-PA | 175 | GI22106-PA | 93..167 | 33..107 | 247 | 57.3 | Plus |
Dmoj\GI22128-PA | 112 | GI22128-PA | 24..109 | 20..105 | 156 | 32.6 | Plus |
Dmoj\GI16321-PA | 114 | GI16321-PA | 8..111 | 6..107 | 148 | 26.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:17:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL15154-PA | 187 | GL15154-PA | 7..74 | 6..73 | 217 | 57.4 | Plus |
Dper\GL15427-PA | 106 | GL15427-PA | 8..104 | 7..105 | 188 | 38.4 | Plus |
Dper\GL15237-PA | 112 | GL15237-PA | 7..108 | 6..106 | 147 | 28.4 | Plus |
Dper\GL15154-PA | 187 | GL15154-PA | 78..187 | 1..107 | 145 | 26.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:17:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25544-PA | 187 | GA25544-PA | 1..74 | 1..73 | 217 | 58.1 | Plus |
Dpse\GA26063-PA | 106 | GA26063-PA | 8..104 | 7..105 | 188 | 38.4 | Plus |
Dpse\GA15367-PA | 112 | GA15367-PA | 6..108 | 5..106 | 147 | 28.2 | Plus |
Dpse\GA25544-PA | 187 | GA25544-PA | 78..187 | 1..107 | 142 | 26.4 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:17:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ19985-PA | 110 | GJ19985-PA | 22..110 | 20..107 | 247 | 50.6 | Plus |
Dvir\GJ19996-PA | 111 | GJ19996-PA | 23..109 | 20..106 | 195 | 42.5 | Plus |
Dvir\GJ15661-PA | 122 | GJ15661-PA | 22..119 | 10..107 | 158 | 28.6 | Plus |
Dvir\GJ17737-PA | 111 | GJ17737-PA | 1..104 | 1..106 | 140 | 31.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:17:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK24349-PA | 105 | GK24349-PA | 18..104 | 20..106 | 278 | 56.3 | Plus |
Dwil\GK19793-PA | 115 | GK19793-PA | 9..112 | 7..107 | 157 | 29.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:17:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18289-PA | 83 | GE18289-PA | 1..63 | 11..73 | 312 | 90.5 | Plus |
Dyak\GE17607-PA | 115 | GE17607-PA | 39..111 | 34..106 | 131 | 31.5 | Plus |
AT09846.hyp Sequence
Translation from 251 to 727
> AT09846.hyp
MDVSFTTAAELASCRLLAATVTTSIRIFPILTAAAGPYFATRQADRSLSI
GCTIVYIYIEICAKCRLFQRLLLFMAFYGAWWFSQLSLIFPSTTTGIQPI
PIAVFSILTQRGYCLKWVRNFAQNSCPARQFYALAMDMECCLRVIKRNHQ
STVTLRII*
Sequence AT09846.hyp has no blast hits.
AT09846.pep Sequence
Translation from 403 to 780
> AT09846.pep
MYNSLYLYRNLCKMSFVPETFIIYGFLWSLVVFPAFANFSLYNYGDSAYP
NCCVLDIDSTRILLKMGQKFRPKFLPCTTILCIGDGYGMLFTCDKKEPPE
HCHFKDYLNGDANYPDCCYRKLECD*
AT09846.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:08:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21439-PA | 114 | GF21439-PA | 38..111 | 49..125 | 136 | 32.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:08:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18842-PA | 113 | GG18842-PA | 4..110 | 16..125 | 141 | 31.8 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:08:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10126-PA | 193 | GH10126-PA | 95..191 | 33..124 | 166 | 36.1 | Plus |
Dgri\GH24561-PA | 114 | GH24561-PA | 24..110 | 35..124 | 144 | 28.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34178-PC | 112 | CG34178-PC | 1..112 | 14..125 | 641 | 100 | Plus |
CG34178-PB | 112 | CG34178-PB | 1..112 | 14..125 | 641 | 100 | Plus |
CG34178-PA | 112 | CG34178-PA | 1..112 | 14..125 | 641 | 100 | Plus |
CG2444-PB | 114 | CG2444-PB | 10..111 | 21..125 | 146 | 32.4 | Plus |
CG2444-PA | 114 | CG2444-PA | 10..111 | 21..125 | 146 | 32.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:08:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI22117-PA | 109 | GI22117-PA | 16..108 | 32..124 | 226 | 44.1 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:08:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL15154-PA | 187 | GL15154-PA | 75..187 | 13..125 | 246 | 39.8 | Plus |
Dper\GL15237-PA | 112 | GL15237-PA | 1..108 | 14..124 | 145 | 28.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:08:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA25544-PA | 187 | GA25544-PA | 75..187 | 13..125 | 235 | 38.9 | Plus |
Dpse\GA15367-PA | 112 | GA15367-PA | 1..108 | 14..124 | 146 | 28.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:08:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13054-PA | 114 | GM13054-PA | 27..111 | 35..125 | 133 | 36.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:08:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15980-PA | 114 | GD15980-PA | 27..111 | 35..125 | 141 | 38.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:08:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ15661-PA | 122 | GJ15661-PA | 4..118 | 5..124 | 144 | 26.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:08:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19793-PA | 115 | GK19793-PA | 18..112 | 23..125 | 139 | 30.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:08:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17607-PA | 115 | GE17607-PA | 25..112 | 35..125 | 140 | 35.2 | Plus |