Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
AT10048.complete Sequence
952 bp (952 high quality bases) assembled on 2005-07-26
GenBank Submission: BT023800
> AT10048.complete
TCTTATTGCACTTCGCTTGAATCTACACCAAATTTCCATTATCTTGATTT
TTTGAATTTTCTACGTTAGCTTTGAACCGAAAATGGTGGTTACTCGCAGT
GCAGCTACGAAGAAGCAGAACCAAGTGCTGACCTTATCTGACCAGAACAT
CCTAGCAGAATCTTCGAGGACCAAAGGACCTCCTGTGCCCAAGAAGAATG
TTAAGAAATTGCCGACTGCACGTCAGTGTGTCAAGGTGGCTGCAAATCTT
CTAGACGCACAAGAACCTAACGAAAATGAAAACACAGGAACCCAAAGGAA
GGATGGAAAGCAACTGGATTCCAAATTGAGTTCCACAGTCCAAAATACAG
AAGCAGCGAGGTCCAAAGAAACTCCTGCACCCAAGAAGAATGTTAAGAAA
CTGCAGGCTGCACTTCCGTGCGCCGACGCGGCTGCAAATCTTTTGGAGGA
ACAAGCATCTAATGAAATGAATGAAGAAGGACCTCCTGTGCCCAAGAAAA
ATGTGAAGAAACTTCCGGCTGCACGTCAGTGTGTCAAGGTGGCTGCAAAT
CTTCTAGACGCACAAGAATCTATCGAAAATGAAAAAACAGGAACAAAAAG
GAAGGATGGGAAGCAACTGCAGGCACAAAATTCGAATGAAAATGAAAAAA
CAAGCACATTAAAGAAGGATAAAAAACTACTGGCTTCCAAAACTCCAGAA
GCAGCGACAAACGATAATGCAAATCCAAATATGAAACCAAGCCTAAAGAA
GTCGACAAGGGAGCACAAGTCCAAAAAGTGTAATGACATTCAAAAAGCTG
GAAAAGATCACATCGAACATCAAGCCGAATAATTTGTATCACGTTGCGTT
AATTGTTTTTGTTTTTAAAGTTCAAAATTGATTTTAGTTGCTTTTATAAG
CAAAAATATAAATATAAATAATTAAGAATACCTAAAAAAAAAAAAAAAAA
AA
AT10048.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:32:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31406-RB | 1047 | CG31406-RB | 115..1047 | 1..933 | 4665 | 100 | Plus |
CG31406.a | 995 | CG31406.a | 7..729 | 1..723 | 3600 | 99.8 | Plus |
CG31406-RA | 702 | CG31406-RA | 251..702 | 477..928 | 2155 | 98.4 | Plus |
CG31406-RA | 702 | CG31406-RA | 78..393 | 1..316 | 1520 | 98.7 | Plus |
CG31406.a | 995 | CG31406.a | 781..995 | 719..933 | 1075 | 100 | Plus |
CG31406-RA | 702 | CG31406-RA | 242..352 | 357..467 | 225 | 80.1 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:34:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 6174927..6175229 | 281..583 | 1500 | 99.7 | Plus |
chr3R | 27901430 | chr3R | 6174585..6174864 | 1..280 | 1400 | 100 | Plus |
chr3R | 27901430 | chr3R | 6175543..6175757 | 719..933 | 1075 | 100 | Plus |
chr3R | 27901430 | chr3R | 6174758..6174864 | 477..583 | 430 | 93.5 | Plus |
chr3R | 27901430 | chr3R | 6175123..6175229 | 174..280 | 415 | 92.5 | Plus |
chr3R | 27901430 | chr3R | 6175415..6175491 | 647..723 | 370 | 98.7 | Plus |
chr3R | 27901430 | chr3R | 6175292..6175354 | 584..646 | 315 | 100 | Plus |
chr3R | 27901430 | chr3R | 6174749..6174859 | 357..467 | 225 | 80.2 | Plus |
chr3R | 27901430 | chr3R | 6175003..6175113 | 165..275 | 225 | 80.2 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:34:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10349180..10349482 | 281..583 | 1515 | 100 | Plus |
3R | 32079331 | 3R | 10348838..10349117 | 1..280 | 1400 | 100 | Plus |
3R | 32079331 | 3R | 10349796..10350019 | 719..942 | 1090 | 99.1 | Plus |
3R | 32079331 | 3R | 10349011..10349117 | 477..583 | 430 | 93.5 | Plus |
3R | 32079331 | 3R | 10349376..10349482 | 174..280 | 430 | 93.5 | Plus |
3R | 32079331 | 3R | 10349668..10349744 | 647..723 | 370 | 98.7 | Plus |
3R | 32079331 | 3R | 10349545..10349607 | 584..646 | 315 | 100 | Plus |
3R | 32079331 | 3R | 10349256..10349366 | 165..275 | 225 | 80.2 | Plus |
3R | 32079331 | 3R | 10349002..10349112 | 357..467 | 225 | 80.2 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 10090011..10090313 | 281..583 | 1515 | 100 | Plus |
3R | 31820162 | 3R | 10089669..10089948 | 1..280 | 1400 | 100 | Plus |
3R | 31820162 | 3R | 10090627..10090850 | 719..942 | 1090 | 99.1 | Plus |
3R | 31820162 | 3R | 10090207..10090313 | 174..280 | 430 | 93.4 | Plus |
3R | 31820162 | 3R | 10089842..10089948 | 477..583 | 430 | 93.4 | Plus |
3R | 31820162 | 3R | 10090499..10090575 | 647..723 | 370 | 98.7 | Plus |
3R | 31820162 | 3R | 10090376..10090438 | 584..646 | 315 | 100 | Plus |
3R | 31820162 | 3R | 10089833..10089943 | 357..467 | 225 | 80.1 | Plus |
3R | 31820162 | 3R | 10090087..10090197 | 165..275 | 225 | 80.1 | Plus |
Blast to na_te.dros performed 2019-03-15 23:34:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Doc3-element | 4740 | Doc3-element DOC3 4740bp | 50..98 | 876..925 | 112 | 72 | Plus |
AT10048.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:35:15 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 6175292..6175354 | 584..646 | 100 | -> | Plus |
chr3R | 6175415..6175486 | 647..718 | 100 | -> | Plus |
chr3R | 6175543..6175723 | 719..899 | 100 | -> | Plus |
chr3R | 6174585..6174864 | 1..280 | 100 | -> | Plus |
chr3R | 6174927..6175229 | 281..583 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:36 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 1..750 | 83..832 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:56:22 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 1..750 | 83..832 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:56 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 1..750 | 83..832 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:06 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 1..750 | 83..832 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:34 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 1..750 | 83..832 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:34:16 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 7..934 | 1..928 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:56:22 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 7..934 | 1..928 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:56 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 78..1010 | 1..933 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:06 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 7..934 | 1..928 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:34 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31406-RB | 78..1010 | 1..933 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10348838..10349117 | 1..280 | 100 | -> | Plus |
3R | 10349180..10349482 | 281..583 | 100 | -> | Plus |
3R | 10349545..10349607 | 584..646 | 100 | -> | Plus |
3R | 10349668..10349739 | 647..718 | 100 | -> | Plus |
3R | 10349796..10350010 | 719..933 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10348838..10349117 | 1..280 | 100 | -> | Plus |
3R | 10349180..10349482 | 281..583 | 100 | -> | Plus |
3R | 10349545..10349607 | 584..646 | 100 | -> | Plus |
3R | 10349668..10349739 | 647..718 | 100 | -> | Plus |
3R | 10349796..10350010 | 719..933 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10348838..10349117 | 1..280 | 100 | -> | Plus |
3R | 10349180..10349482 | 281..583 | 100 | -> | Plus |
3R | 10349545..10349607 | 584..646 | 100 | -> | Plus |
3R | 10349668..10349739 | 647..718 | 100 | -> | Plus |
3R | 10349796..10350010 | 719..933 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:56 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 6174902..6175204 | 281..583 | 100 | -> | Plus |
arm_3R | 6175267..6175329 | 584..646 | 100 | -> | Plus |
arm_3R | 6175390..6175461 | 647..718 | 100 | -> | Plus |
arm_3R | 6175518..6175732 | 719..933 | 100 | | Plus |
arm_3R | 6174560..6174839 | 1..280 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:15:42 Download gff for
AT10048.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10089669..10089948 | 1..280 | 100 | -> | Plus |
3R | 10090011..10090313 | 281..583 | 100 | -> | Plus |
3R | 10090376..10090438 | 584..646 | 100 | -> | Plus |
3R | 10090499..10090570 | 647..718 | 100 | -> | Plus |
3R | 10090627..10090841 | 719..933 | 100 | | Plus |
AT10048.pep Sequence
Translation from 82 to 831
> AT10048.pep
MVVTRSAATKKQNQVLTLSDQNILAESSRTKGPPVPKKNVKKLPTARQCV
KVAANLLDAQEPNENENTGTQRKDGKQLDSKLSSTVQNTEAARSKETPAP
KKNVKKLQAALPCADAAANLLEEQASNEMNEEGPPVPKKNVKKLPAARQC
VKVAANLLDAQESIENEKTGTKRKDGKQLQAQNSNENEKTSTLKKDKKLL
ASKTPEAATNDNANPNMKPSLKKSTREHKSKKCNDIQKAGKDHIEHQAE*
AT10048.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31406-PB | 249 | CG31406-PB | 1..249 | 1..249 | 1259 | 100 | Plus |
CG31406-PA | 148 | CG31406-PA | 10..148 | 105..249 | 591 | 83.4 | Plus |
CG31406-PA | 148 | CG31406-PA | 1..109 | 1..119 | 394 | 72.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:33:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23878-PA | 232 | GM23878-PA | 1..231 | 1..248 | 711 | 66.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:33:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18689-PA | 270 | GD18689-PA | 1..269 | 1..248 | 643 | 59.2 | Plus |
AT10048.hyp Sequence
Translation from 82 to 831
> AT10048.hyp
MVVTRSAATKKQNQVLTLSDQNILAESSRTKGPPVPKKNVKKLPTARQCV
KVAANLLDAQEPNENENTGTQRKDGKQLDSKLSSTVQNTEAARSKETPAP
KKNVKKLQAALPCADAAANLLEEQASNEMNEEGPPVPKKNVKKLPAARQC
VKVAANLLDAQESIENEKTGTKRKDGKQLQAQNSNENEKTSTLKKDKKLL
ASKTPEAATNDNANPNMKPSLKKSTREHKSKKCNDIQKAGKDHIEHQAE*
AT10048.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:01:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31406-PB | 249 | CG31406-PB | 1..249 | 1..249 | 1259 | 100 | Plus |
CG31406-PA | 148 | CG31406-PA | 10..148 | 105..249 | 591 | 83.4 | Plus |
CG31406-PA | 148 | CG31406-PA | 1..109 | 1..119 | 394 | 72.3 | Plus |