Clone AT10048 Report

Search the DGRC for AT10048

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:100
Well:48
Vector:pOTB7
Associated Gene/TranscriptCG31406-RB
Protein status:AT10048.pep: gold
Sequenced Size:952

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31406 2008-04-29 Release 5.5 accounting
CG31406 2008-08-15 Release 5.9 accounting
CG31406 2008-12-18 5.12 accounting

Clone Sequence Records

AT10048.complete Sequence

952 bp (952 high quality bases) assembled on 2005-07-26

GenBank Submission: BT023800

> AT10048.complete
TCTTATTGCACTTCGCTTGAATCTACACCAAATTTCCATTATCTTGATTT
TTTGAATTTTCTACGTTAGCTTTGAACCGAAAATGGTGGTTACTCGCAGT
GCAGCTACGAAGAAGCAGAACCAAGTGCTGACCTTATCTGACCAGAACAT
CCTAGCAGAATCTTCGAGGACCAAAGGACCTCCTGTGCCCAAGAAGAATG
TTAAGAAATTGCCGACTGCACGTCAGTGTGTCAAGGTGGCTGCAAATCTT
CTAGACGCACAAGAACCTAACGAAAATGAAAACACAGGAACCCAAAGGAA
GGATGGAAAGCAACTGGATTCCAAATTGAGTTCCACAGTCCAAAATACAG
AAGCAGCGAGGTCCAAAGAAACTCCTGCACCCAAGAAGAATGTTAAGAAA
CTGCAGGCTGCACTTCCGTGCGCCGACGCGGCTGCAAATCTTTTGGAGGA
ACAAGCATCTAATGAAATGAATGAAGAAGGACCTCCTGTGCCCAAGAAAA
ATGTGAAGAAACTTCCGGCTGCACGTCAGTGTGTCAAGGTGGCTGCAAAT
CTTCTAGACGCACAAGAATCTATCGAAAATGAAAAAACAGGAACAAAAAG
GAAGGATGGGAAGCAACTGCAGGCACAAAATTCGAATGAAAATGAAAAAA
CAAGCACATTAAAGAAGGATAAAAAACTACTGGCTTCCAAAACTCCAGAA
GCAGCGACAAACGATAATGCAAATCCAAATATGAAACCAAGCCTAAAGAA
GTCGACAAGGGAGCACAAGTCCAAAAAGTGTAATGACATTCAAAAAGCTG
GAAAAGATCACATCGAACATCAAGCCGAATAATTTGTATCACGTTGCGTT
AATTGTTTTTGTTTTTAAAGTTCAAAATTGATTTTAGTTGCTTTTATAAG
CAAAAATATAAATATAAATAATTAAGAATACCTAAAAAAAAAAAAAAAAA
AA

AT10048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG31406-RB 1047 CG31406-RB 115..1047 1..933 4665 100 Plus
CG31406.a 995 CG31406.a 7..729 1..723 3600 99.8 Plus
CG31406-RA 702 CG31406-RA 251..702 477..928 2155 98.4 Plus
CG31406-RA 702 CG31406-RA 78..393 1..316 1520 98.7 Plus
CG31406.a 995 CG31406.a 781..995 719..933 1075 100 Plus
CG31406-RA 702 CG31406-RA 242..352 357..467 225 80.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6174927..6175229 281..583 1500 99.7 Plus
chr3R 27901430 chr3R 6174585..6174864 1..280 1400 100 Plus
chr3R 27901430 chr3R 6175543..6175757 719..933 1075 100 Plus
chr3R 27901430 chr3R 6174758..6174864 477..583 430 93.5 Plus
chr3R 27901430 chr3R 6175123..6175229 174..280 415 92.5 Plus
chr3R 27901430 chr3R 6175415..6175491 647..723 370 98.7 Plus
chr3R 27901430 chr3R 6175292..6175354 584..646 315 100 Plus
chr3R 27901430 chr3R 6174749..6174859 357..467 225 80.2 Plus
chr3R 27901430 chr3R 6175003..6175113 165..275 225 80.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10349180..10349482 281..583 1515 100 Plus
3R 32079331 3R 10348838..10349117 1..280 1400 100 Plus
3R 32079331 3R 10349796..10350019 719..942 1090 99.1 Plus
3R 32079331 3R 10349011..10349117 477..583 430 93.5 Plus
3R 32079331 3R 10349376..10349482 174..280 430 93.5 Plus
3R 32079331 3R 10349668..10349744 647..723 370 98.7 Plus
3R 32079331 3R 10349545..10349607 584..646 315 100 Plus
3R 32079331 3R 10349256..10349366 165..275 225 80.2 Plus
3R 32079331 3R 10349002..10349112 357..467 225 80.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10090011..10090313 281..583 1515 100 Plus
3R 31820162 3R 10089669..10089948 1..280 1400 100 Plus
3R 31820162 3R 10090627..10090850 719..942 1090 99.1 Plus
3R 31820162 3R 10090207..10090313 174..280 430 93.4 Plus
3R 31820162 3R 10089842..10089948 477..583 430 93.4 Plus
3R 31820162 3R 10090499..10090575 647..723 370 98.7 Plus
3R 31820162 3R 10090376..10090438 584..646 315 100 Plus
3R 31820162 3R 10089833..10089943 357..467 225 80.1 Plus
3R 31820162 3R 10090087..10090197 165..275 225 80.1 Plus
Blast to na_te.dros performed 2019-03-15 23:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 50..98 876..925 112 72 Plus

AT10048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:35:15 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6175292..6175354 584..646 100 -> Plus
chr3R 6175415..6175486 647..718 100 -> Plus
chr3R 6175543..6175723 719..899 100 -> Plus
chr3R 6174585..6174864 1..280 100 -> Plus
chr3R 6174927..6175229 281..583 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:36 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 1..750 83..832 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:56:22 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 1..750 83..832 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:42:56 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 1..750 83..832 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:37:06 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 1..750 83..832 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:34 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 1..750 83..832 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:34:16 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 7..934 1..928 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:56:22 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 7..934 1..928 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:42:56 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 78..1010 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:06 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 7..934 1..928 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:34 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
CG31406-RB 78..1010 1..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10348838..10349117 1..280 100 -> Plus
3R 10349180..10349482 281..583 100 -> Plus
3R 10349545..10349607 584..646 100 -> Plus
3R 10349668..10349739 647..718 100 -> Plus
3R 10349796..10350010 719..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10348838..10349117 1..280 100 -> Plus
3R 10349180..10349482 281..583 100 -> Plus
3R 10349545..10349607 584..646 100 -> Plus
3R 10349668..10349739 647..718 100 -> Plus
3R 10349796..10350010 719..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:15 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10348838..10349117 1..280 100 -> Plus
3R 10349180..10349482 281..583 100 -> Plus
3R 10349545..10349607 584..646 100 -> Plus
3R 10349668..10349739 647..718 100 -> Plus
3R 10349796..10350010 719..933 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:42:56 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6174902..6175204 281..583 100 -> Plus
arm_3R 6175267..6175329 584..646 100 -> Plus
arm_3R 6175390..6175461 647..718 100 -> Plus
arm_3R 6175518..6175732 719..933 100   Plus
arm_3R 6174560..6174839 1..280 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:15:42 Download gff for AT10048.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10089669..10089948 1..280 100 -> Plus
3R 10090011..10090313 281..583 100 -> Plus
3R 10090376..10090438 584..646 100 -> Plus
3R 10090499..10090570 647..718 100 -> Plus
3R 10090627..10090841 719..933 100   Plus

AT10048.pep Sequence

Translation from 82 to 831

> AT10048.pep
MVVTRSAATKKQNQVLTLSDQNILAESSRTKGPPVPKKNVKKLPTARQCV
KVAANLLDAQEPNENENTGTQRKDGKQLDSKLSSTVQNTEAARSKETPAP
KKNVKKLQAALPCADAAANLLEEQASNEMNEEGPPVPKKNVKKLPAARQC
VKVAANLLDAQESIENEKTGTKRKDGKQLQAQNSNENEKTSTLKKDKKLL
ASKTPEAATNDNANPNMKPSLKKSTREHKSKKCNDIQKAGKDHIEHQAE*

AT10048.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG31406-PB 249 CG31406-PB 1..249 1..249 1259 100 Plus
CG31406-PA 148 CG31406-PA 10..148 105..249 591 83.4 Plus
CG31406-PA 148 CG31406-PA 1..109 1..119 394 72.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23878-PA 232 GM23878-PA 1..231 1..248 711 66.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18689-PA 270 GD18689-PA 1..269 1..248 643 59.2 Plus

AT10048.hyp Sequence

Translation from 82 to 831

> AT10048.hyp
MVVTRSAATKKQNQVLTLSDQNILAESSRTKGPPVPKKNVKKLPTARQCV
KVAANLLDAQEPNENENTGTQRKDGKQLDSKLSSTVQNTEAARSKETPAP
KKNVKKLQAALPCADAAANLLEEQASNEMNEEGPPVPKKNVKKLPAARQC
VKVAANLLDAQESIENEKTGTKRKDGKQLQAQNSNENEKTSTLKKDKKLL
ASKTPEAATNDNANPNMKPSLKKSTREHKSKKCNDIQKAGKDHIEHQAE*

AT10048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31406-PB 249 CG31406-PB 1..249 1..249 1259 100 Plus
CG31406-PA 148 CG31406-PA 10..148 105..249 591 83.4 Plus
CG31406-PA 148 CG31406-PA 1..109 1..119 394 72.3 Plus