Clone AT10251 Report

Search the DGRC for AT10251

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:102
Well:51
Vector:pOTB7
Associated Gene/Transcriptmod(r)-RB
Protein status:AT10251.pep: gold
Sequenced Size:1080

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mod(r)-RB 2010-02-12 Manual selection by Ken Wan

Clone Sequence Records

AT10251.complete Sequence

1080 bp assembled on 2010-03-02

GenBank Submission: BT122033.1

> AT10251.complete
CAGACACATTGACATTCGAAAATTGGGATTGAAAACTCAAGATGCCGACT
ACACCACAGGATCTTGCCCTTGCCCACTCTCTTGCTCAAAGACCTCCGAC
CGATAGCAGTGAGGCCAAGGAGCAGGAGGCCGGCGAATCGGACAACCTGC
CCAACCTGTGCACTTTGTCGCTGGACGAACTGAAACAGCTGGACAGGGAT
CCCGAGTTCTTCGAGGACTTCATCGAGGAGATGTCCGTGGTGCAGTACCT
GAACGAGGAGCTCGATTCAATGATGGACCAGGTGGAGATTATATCAAGAG
AGAACGAGTGCAAGGGCATTCATCTGGTAGAGCTGAAGCGCCGACTCAGC
GACGATTTTACAGCTTTAAAAAACCTAGGCGAGAAATGCGACCGGCTGAA
CAAGAAGTACTTCAAGAAGTCGGATGAATACGCGCCTCAGCATATCAGGA
TTGCAGCTTCCAATGCCGATGGCGACTGCGATCGTCACGTGGAGCACTTC
CTGAACGGAAAGACCGACGTGCAGACTTTCCTCAACACGTACCAGTGGTC
GAAGAAGATCAGTACCGAGCGCAAGGCCAAAGAGGAGCGCCTGGGCACCC
AGCTCAGTGCTCTGGAGCGGGCCGGTATCTAGGATTGCCGTGACACTCCC
TGGCCGTGCCATCCAGAGCACGGTCCTCCCACTCCTCGCACTCCTCCCAC
ACCGCCACGATCCGCGTCGCAATAGTAGAGAATATCAATGTTAGTAAATA
GAGAAGTTAAGCCAGAGATGGGGCGACATAATCATGGCACACACGGCCAC
GCATTCCCAGAACAGAAAGCAAAACCTTGTTGAAGTAATAAGAAGGTGCA
CTAGTTGTTCGTTTCCCAAGATCGTTTACTTGGGAAGAGGGTCTTGTTAT
TCTATCCGTACCCCGAAACGAAGCACTATGTGCAACAGAACGCAGTCCGG
AATCGCATGTATTACCTATTTACTTTTTTTCCTTTTGGTTAATCGTGAGC
CCCATCCATATATTCTCTCCATATATACATATATATTAAAAAAAAACTAT
GCTTTAAAAAAAAAAAAAAAAAAAAAAAAA

AT10251.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
mod(r)-RD 1371 mod(r)-RD 306..1363 1..1058 5290 100 Plus
mod(r)-RC 1372 mod(r)-RC 755..1364 449..1058 3050 100 Plus
mod(r)-RA 1355 mod(r)-RA 750..1355 449..1054 3030 100 Plus
mod(r)-RA 1355 mod(r)-RA 290..738 1..449 2245 100 Plus
mod(r)-RC 1372 mod(r)-RC 297..743 3..449 2235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 516438..517044 449..1055 3035 100 Plus
chrX 22417052 chrX 515843..516144 1..302 1495 99.7 Plus
chrX 22417052 chrX 516200..516351 298..449 760 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 622445..623054 449..1058 3050 100 Plus
X 23542271 X 621850..622151 1..302 1495 99.7 Plus
X 23542271 X 622207..622358 298..449 760 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 630543..631152 449..1058 3050 100 Plus
X 23527363 X 629948..630249 1..302 1495 99.6 Plus
X 23527363 X 630305..630456 298..449 760 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:54:02 has no hits.

AT10251.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:55:12 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 515843..516139 1..297 100 -> Plus
chrX 516200..516351 298..449 100 -> Plus
chrX 516439..517044 450..1055 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-03-03 09:16:55 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 1..591 42..632 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:55:45 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 1..591 42..632 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:23:50 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 1..591 42..632 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:19 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 1..591 42..632 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-03-03 09:16:51 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RD 271..1322 1..1052 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:55:45 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RD 271..1322 1..1052 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:23:50 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 45..1099 1..1055 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:19 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
mod(r)-RB 45..1099 1..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:12 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
X 621850..622146 1..297 100 -> Plus
X 622207..622358 298..449 100 -> Plus
X 622446..623051 450..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:12 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
X 621850..622146 1..297 100 -> Plus
X 622207..622358 298..449 100 -> Plus
X 622446..623051 450..1055 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:12 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
X 621850..622146 1..297 100 -> Plus
X 622207..622358 298..449 100 -> Plus
X 622446..623051 450..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:23:50 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 515883..516179 1..297 100 -> Plus
arm_X 516240..516391 298..449 100 -> Plus
arm_X 516479..517084 450..1055 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:32:17 Download gff for AT10251.complete
Subject Subject Range Query Range Percent Splice Strand
X 629948..630244 1..297 100 -> Plus
X 630305..630456 298..449 100 -> Plus
X 630544..631149 450..1055 100   Plus

AT10251.hyp Sequence

Translation from 41 to 631

> AT10251.hyp
MPTTPQDLALAHSLAQRPPTDSSEAKEQEAGESDNLPNLCTLSLDELKQL
DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKR
RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRIAASNADGDCDRHV
EHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERAGI*

AT10251.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
mod(r)-PE 196 CG17828-PE 1..196 1..196 1016 100 Plus
mod(r)-PD 196 CG17828-PD 1..196 1..196 1016 100 Plus
mod(r)-PB 196 CG17828-PB 1..196 1..196 1016 100 Plus
mod(r)-PF 200 CG17828-PF 1..200 1..196 1001 98 Plus
mod(r)-PC 200 CG17828-PC 1..200 1..196 1001 98 Plus

AT10251.pep Sequence

Translation from 41 to 631

> AT10251.pep
MPTTPQDLALAHSLAQRPPTDSSEAKEQEAGESDNLPNLCTLSLDELKQL
DRDPEFFEDFIEEMSVVQYLNEELDSMMDQVEIISRENECKGIHLVELKR
RLSDDFTALKNLGEKCDRLNKKYFKKSDEYAPQHIRIAASNADGDCDRHV
EHFLNGKTDVQTFLNTYQWSKKISTERKAKEERLGTQLSALERAGI*

AT10251.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22102-PA 216 GF22102-PA 27..216 11..196 762 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12797-PA 203 GG12797-PA 1..203 1..196 840 80.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24324-PA 194 GH24324-PA 28..194 34..196 742 84.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Vsp37A-PE 196 CG17828-PE 1..196 1..196 1016 100 Plus
Vsp37A-PD 196 CG17828-PD 1..196 1..196 1016 100 Plus
Vsp37A-PB 196 CG17828-PB 1..196 1..196 1016 100 Plus
Vsp37A-PF 200 CG17828-PF 1..200 1..196 1001 98 Plus
Vsp37A-PC 200 CG17828-PC 1..200 1..196 1001 98 Plus
Vsp37A-PA 200 CG17828-PA 1..200 1..196 1001 98 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14804-PA 205 GI14804-PA 37..205 32..196 756 85.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21382-PA 201 GL21382-PA 36..201 35..196 758 87.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14686-PA 201 GA14686-PA 36..201 35..196 758 87.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19076-PA 200 GM19076-PA 1..200 1..196 1006 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16515-PA 200 GD16515-PA 1..200 1..196 1012 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19471-PA 198 GJ19471-PA 30..198 32..196 759 86.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16437-PA 205 GK16437-PA 36..205 31..196 746 85.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16623-PA 203 GE16623-PA 1..203 1..196 855 82.3 Plus