Clone AT10515 Report

Search the DGRC for AT10515

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:105
Well:15
Vector:pOTB7
Associated Gene/TranscriptCG14921-RA
Protein status:AT10515.pep: gold
Preliminary Size:723
Sequenced Size:940

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14921 2002-01-01 Sim4 clustering to Release 2
CG14921 2002-02-22 Blastp of sequenced clone
CG14921 2003-01-01 Sim4 clustering to Release 3
CG14921 2008-04-29 Release 5.5 accounting
CG14921 2008-08-15 Release 5.9 accounting
CG14921 2008-12-18 5.12 accounting

Clone Sequence Records

AT10515.complete Sequence

940 bp (940 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089304

> AT10515.complete
CAAAAACATAAGTTCCTTCCTATTGTCAGTCGCAGACCAGCAGCAGAAGA
ACCACGGCCATAGCAGCGCAAACGAACAGGGAAGCCAAGCAACTCATCAT
GGTACAGATTTCGCAGACAGAGGAGGACATCAAGATCTCCATCGAACTCA
ATCGTCTGGTAACCCGCAAGCCGGACGTTGTTCTCCTTCCGCAGTACTTA
AAGTTCAACAATCCACCCATCTTCTTTGAGCGTCATCTGGCCCAGGAGAT
CGACGAGATGGCCAGCTTTTGTCGCATTTTTAAGAACGAAGCCCGCATTG
TGCTGGTTAAGAAAGAGAAGGGCTTATGGCCTGAGATGTTCCAGAAGCTG
GACAAGGAGGCACTCATGCAGAAGCGCCTAGAGATCGCCGACCTCATCGT
GGAGCGCAACAAGAAGCGGGATGAAAAGGCACTGGAACGTTACGATAACA
AGCGGCGGGCGGAGATCCAGAAGGAGATCCAGCGGGAGACAGATATGCGC
GAGCGTGTGAAGCAGTTCCAGGAGAACTCGGTGCGCGAAGCTCTGGTAGT
GGATGTACGCAAGGAGGCGAAAGCTACGCCCAAGCCAGATACACTGCAGT
ATCCGCCATCGTCGGGAGGCGCCAGTCGCCTGGCCACGCCCCTCATGCGT
CCGCCCATGAGCTCCGTTCGTGGCAGCGGACGGATCAACGTAAACTTCAC
CACACAGCACAAGCGGGTCACGCCGAAGCGGGAGTCGCAGGCCGCTATGG
AGAAGGCATATGCCGCCGCCGGTGGACCCAATGCGAATGTCCAGTCGCCG
ATGGAGAGCGTCGATGAATAAGCGTTACATGTCAATTAGCGCGTGCGTGC
GAGACTGTGCTAATATTCCTATTTTATTATTGCATCAAATAAATCTACAG
GTGTTTGTTTAGTTGAATCAGCAAAAAAAAAAAAAAAAAA

AT10515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:27:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14921.a 1476 CG14921.a 541..1463 1..923 4615 100 Plus
CG14921.b 1732 CG14921.b 797..1719 1..923 4615 100 Plus
CG14921-RA 1377 CG14921-RA 442..1364 1..923 4615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11119397..11120056 922..263 3300 100 Minus
chr2L 23010047 chr2L 11120174..11120438 265..1 1325 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:44:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11120641..11121301 923..263 3305 100 Minus
2L 23513712 2L 11121419..11121683 265..1 1325 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11120641..11121301 923..263 3305 100 Minus
2L 23513712 2L 11121419..11121683 265..1 1325 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:54:00 has no hits.

AT10515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:55:05 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11120174..11120438 1..265 100   Minus
chr2L 11119397..11120053 266..922 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:58:58 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..723 99..821 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:42:09 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..723 99..821 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:49:48 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..723 99..821 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:11:06 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..723 99..821 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:49:49 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..723 99..821 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:06:55 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..922 1..922 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:42:08 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..922 1..922 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:49:48 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..922 1..922 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:11:06 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 1..922 1..922 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:49:49 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14921-RA 32..953 1..922 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:05 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11120642..11121298 266..922 100 <- Minus
2L 11121419..11121683 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:05 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11120642..11121298 266..922 100 <- Minus
2L 11121419..11121683 1..265 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:55:05 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11120642..11121298 266..922 100 <- Minus
2L 11121419..11121683 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:49:48 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11120642..11121298 266..922 100 <- Minus
arm_2L 11121419..11121683 1..265 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:45:30 Download gff for AT10515.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11120642..11121298 266..922 100 <- Minus
2L 11121419..11121683 1..265 100   Minus

AT10515.pep Sequence

Translation from 98 to 820

> AT10515.pep
MVQISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQE
IDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIADLI
VERNKKRDEKALERYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALV
VDVRKEAKATPKPDTLQYPPSSGGASRLATPLMRPPMSSVRGSGRINVNF
TTQHKRVTPKRESQAAMEKAYAAAGGPNANVQSPMESVDE*

AT10515.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14227-PA 230 GF14227-PA 1..230 1..240 943 82.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10325-PA 240 GG10325-PA 1..240 1..240 1176 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:01:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10968-PA 257 GH10968-PA 1..257 1..240 849 67.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG14921-PA 240 CG14921-PA 1..240 1..240 1212 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18152-PA 256 GI18152-PA 1..256 1..240 828 66 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18588-PA 245 GL18588-PA 1..245 1..240 977 75.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:01:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13355-PA 245 GA13355-PA 1..245 1..240 977 75.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11145-PA 240 GM11145-PA 1..240 1..240 1252 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22192-PA 239 GD22192-PA 1..239 1..240 1220 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14559-PA 254 GJ14559-PA 1..254 1..240 840 67.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:01:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15243-PA 246 GK15243-PA 1..246 1..240 886 72 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12988-PA 240 GE12988-PA 1..240 1..240 1193 93.8 Plus

AT10515.hyp Sequence

Translation from 98 to 820

> AT10515.hyp
MVQISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQE
IDEMASFCRIFKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIADLI
VERNKKRDEKALERYDNKRRAEIQKEIQRETDMRERVKQFQENSVREALV
VDVRKEAKATPKPDTLQYPPSSGGASRLATPLMRPPMSSVRGSGRINVNF
TTQHKRVTPKRESQAAMEKAYAAAGGPNANVQSPMESVDE*

AT10515.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14921-PA 240 CG14921-PA 1..240 1..240 1212 100 Plus