Clone AT10824 Report

Search the DGRC for AT10824

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:108
Well:24
Vector:pOTB7
Associated Gene/TranscriptCG11298-RA
Protein status:AT10824.pep: gold
Preliminary Size:501
Sequenced Size:587

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11298 2002-01-01 Sim4 clustering to Release 2
CG11298 2002-04-26 Blastp of sequenced clone
CG11298 2003-01-01 Sim4 clustering to Release 3
CG11298 2008-04-29 Release 5.5 accounting
CG11298 2008-08-15 Release 5.9 accounting
CG11298 2008-12-18 5.12 accounting

Clone Sequence Records

AT10824.complete Sequence

587 bp (587 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113230

> AT10824.complete
CGCAGTCAGCTCTTGAATTTATGTACATTATTTTTGGTCCCCGTTACTAT
ATTTTTCCCAAATTATGAGCAACTCATCGGCCTTTTACGTGCATTTGGAG
GATCCTGTGCGGAGTGATCCCCCCAGTGGACTGCATCGCAAGTATCGCCC
ATTTCCGACCCGCCCCCATGAGGAGCGTCTGGAGGAGGCGGAGGAGCGAC
GCAATCGGCTGGGTGAGCACAAGGTGGAGCAGCTGTCCGTTCGTCTGGCG
CGAGTGGCGCTGATCACGGATCGTCACCATCGCCAGACCACCCAAAGTTG
GCTAGACTCCCAAGATCGCATTACTCGCGACATGGACGAACATGTGCGCA
AGCGGACGGCCCAGATCTCGAAACGTCTGAGAAACCTCAGCGATCACAAC
CACAAGGTTCAGGTGCGCAAGGACGAGGCCAAGCAGGAGAAGCTTCTCCG
AAAACTGACTCATCTCTACGAGGCGCAGAACGCCAGCACTATTTCGCGAT
TTTGGGGCAAAATTCACAAGTAGGCTGTAAGTCGAAGTAAATAAATTTGG
CAGTCGATTCAGAAGCAATAAAAAAAAAAAAAAAAAA

AT10824.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG11298-RA 576 CG11298-RA 1..571 1..571 2840 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18234867..18235435 1..569 2800 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:45:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22348307..22348877 1..571 2840 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22349506..22350076 1..571 2840 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 18:42:03 has no hits.

AT10824.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:42:45 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18234867..18235435 1..569 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:59:08 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:56 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:28 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:18 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:47:24 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:39 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..569 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:56 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..569 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:28 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..569 1..569 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:18 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..569 1..569 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:47:24 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11298-RA 1..569 1..569 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:45 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22348307..22348875 1..569 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:45 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22348307..22348875 1..569 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:42:45 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22348307..22348875 1..569 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:28 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18235812..18236380 1..569 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:10 Download gff for AT10824.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22349506..22350074 1..569 99   Plus

AT10824.pep Sequence

Translation from 64 to 522

> AT10824.pep
MSNSSAFYVHLEDPVRSDPPSGLHRKYRPFPTRPHEERLEEAEERRNRLG
EHKVEQLSVRLARVALITDRHHRQTTQSWLDSQDRITRDMDEHVRKRTAQ
ISKRLRNLSDHNHKVQVRKDEAKQEKLLRKLTHLYEAQNASTISRFWGKI
HK*

AT10824.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11884-PA 162 GF11884-PA 14..160 2..148 420 62.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22182-PA 154 GG22182-PA 5..154 3..152 609 90.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21803-PA 149 GH21803-PA 8..122 4..118 135 32.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG11298-PA 152 CG11298-PA 1..152 1..152 796 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17537-PA 162 GL17537-PA 21..160 3..142 263 44.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10898-PA 162 GA10898-PA 21..160 3..142 260 44.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15902-PA 152 GM15902-PA 1..152 1..152 671 93.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11661-PA 152 GD11661-PA 1..152 1..152 688 95.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22406-PA 182 GJ22406-PA 43..157 6..120 190 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14175-PA 154 GE14175-PA 5..154 3..152 651 92 Plus

AT10824.hyp Sequence

Translation from 64 to 522

> AT10824.hyp
MSNSSAFYVHLEDPVRSDPPSGLHRKYRPFPTRPHEERLEEAEERRNRLG
EHKVEQLSVRLARVALITDRHHRQTTQSWLDSQDRITRDMDEHVRKRTAQ
ISKRLRNLSDHNHKVQVRKDEAKQEKLLRKLTHLYEAQNASTISRFWGKI
HK*

AT10824.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:02:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11298-PA 152 CG11298-PA 1..152 1..152 796 100 Plus