BDGP Sequence Production Resources |
Search the DGRC for AT10824
Library: | AT |
Tissue Source: | Drosophila melanogaster adult testes |
Created by: | Ling Hong |
Date Registered: | 2000-06-08 |
Comments: | Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7 |
Original Plate Number: | 108 |
Well: | 24 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG11298-RA |
Protein status: | AT10824.pep: gold |
Preliminary Size: | 501 |
Sequenced Size: | 587 |
Gene | Date | Evidence |
---|---|---|
CG11298 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11298 | 2002-04-26 | Blastp of sequenced clone |
CG11298 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11298 | 2008-04-29 | Release 5.5 accounting |
CG11298 | 2008-08-15 | Release 5.9 accounting |
CG11298 | 2008-12-18 | 5.12 accounting |
587 bp (587 high quality bases) assembled on 2002-04-26
GenBank Submission: AY113230
> AT10824.complete CGCAGTCAGCTCTTGAATTTATGTACATTATTTTTGGTCCCCGTTACTAT ATTTTTCCCAAATTATGAGCAACTCATCGGCCTTTTACGTGCATTTGGAG GATCCTGTGCGGAGTGATCCCCCCAGTGGACTGCATCGCAAGTATCGCCC ATTTCCGACCCGCCCCCATGAGGAGCGTCTGGAGGAGGCGGAGGAGCGAC GCAATCGGCTGGGTGAGCACAAGGTGGAGCAGCTGTCCGTTCGTCTGGCG CGAGTGGCGCTGATCACGGATCGTCACCATCGCCAGACCACCCAAAGTTG GCTAGACTCCCAAGATCGCATTACTCGCGACATGGACGAACATGTGCGCA AGCGGACGGCCCAGATCTCGAAACGTCTGAGAAACCTCAGCGATCACAAC CACAAGGTTCAGGTGCGCAAGGACGAGGCCAAGCAGGAGAAGCTTCTCCG AAAACTGACTCATCTCTACGAGGCGCAGAACGCCAGCACTATTTCGCGAT TTTGGGGCAAAATTCACAAGTAGGCTGTAAGTCGAAGTAAATAAATTTGG CAGTCGATTCAGAAGCAATAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11298-RA | 576 | CG11298-RA | 1..571 | 1..571 | 2840 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 18234867..18235435 | 1..569 | 2800 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 22348307..22348877 | 1..571 | 2840 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 22349506..22350076 | 1..571 | 2840 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 18234867..18235435 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..459 | 65..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..459 | 65..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..459 | 65..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..459 | 65..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..459 | 65..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..569 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..569 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..569 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..569 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11298-RA | 1..569 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22348307..22348875 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22348307..22348875 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22348307..22348875 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 18235812..18236380 | 1..569 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 22349506..22350074 | 1..569 | 99 | Plus |
Translation from 64 to 522
> AT10824.pep MSNSSAFYVHLEDPVRSDPPSGLHRKYRPFPTRPHEERLEEAEERRNRLG EHKVEQLSVRLARVALITDRHHRQTTQSWLDSQDRITRDMDEHVRKRTAQ ISKRLRNLSDHNHKVQVRKDEAKQEKLLRKLTHLYEAQNASTISRFWGKI HK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11884-PA | 162 | GF11884-PA | 14..160 | 2..148 | 420 | 62.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22182-PA | 154 | GG22182-PA | 5..154 | 3..152 | 609 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21803-PA | 149 | GH21803-PA | 8..122 | 4..118 | 135 | 32.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11298-PA | 152 | CG11298-PA | 1..152 | 1..152 | 796 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17537-PA | 162 | GL17537-PA | 21..160 | 3..142 | 263 | 44.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10898-PA | 162 | GA10898-PA | 21..160 | 3..142 | 260 | 44.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15902-PA | 152 | GM15902-PA | 1..152 | 1..152 | 671 | 93.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11661-PA | 152 | GD11661-PA | 1..152 | 1..152 | 688 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22406-PA | 182 | GJ22406-PA | 43..157 | 6..120 | 190 | 37.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14175-PA | 154 | GE14175-PA | 5..154 | 3..152 | 651 | 92 | Plus |
Translation from 64 to 522
> AT10824.hyp MSNSSAFYVHLEDPVRSDPPSGLHRKYRPFPTRPHEERLEEAEERRNRLG EHKVEQLSVRLARVALITDRHHRQTTQSWLDSQDRITRDMDEHVRKRTAQ ISKRLRNLSDHNHKVQVRKDEAKQEKLLRKLTHLYEAQNASTISRFWGKI HK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11298-PA | 152 | CG11298-PA | 1..152 | 1..152 | 796 | 100 | Plus |