Clone AT11049 Report

Search the DGRC for AT11049

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:110
Well:49
Vector:pOTB7
Associated Gene/TranscriptCG13405-RA
Protein status:AT11049.pep: gold
Preliminary Size:573
Sequenced Size:798

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13405 2002-01-01 Sim4 clustering to Release 2
CG13405 2002-04-26 Blastp of sequenced clone
CG13405 2003-01-01 Sim4 clustering to Release 3
CG13405 2008-04-29 Release 5.5 accounting
CG13405 2008-08-15 Release 5.9 accounting
CG13405 2008-12-18 5.12 accounting

Clone Sequence Records

AT11049.complete Sequence

798 bp (798 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113231

> AT11049.complete
ATGTAAACTAATACCCCTGCATCGCTTAATACAATTTATCCCTAACATCC
GAAGCAATGTCTGATGTGGAGCAAGAAGCCTCTGGAGACGTTGATAATGA
GCAAAATGAAGGACAAGAAGCTGCTGAAGATTTTGAGGGAGAGGGCGAAG
GAGACGAACAGGACGTTGAAGAGGAAGATAAGTTCGAGGTGGAGGAGAAG
GATCCCTTTGAGCTCCTCAATGAGAGCGATGAAGACGATGAAGAGCAACA
GGCAATGTACAAGGAGTATCAGGAGGTGGTCAACGCTATTGATGCGCAGA
ACAGGATTATAAAAGAGCTCAAGGCAAAGTCCAATCGACTGATGTTCAAG
AAGTGCAAGACTTATAGAGACAAGCAGGAATACAAACAACTTAGGGTCTG
TCAGGAGCATGAGGAGATCCATTTAAAGGTTCTCGTGAATAGAGCCATGC
ACCTCCAAAACTTCGGTTCACCTAGGCGCTACAGAGATATAGAAATGGAA
GTCACAGAGGACGAGAAGAGCTACTTTTATACTGAACTACAATCGACCTT
ATCAGGCTTTTGTCCCACGGATTCGGCTGACGAATATGAGTCGGATTCTG
AATCGGATAATGGACTATGTTGTACCTAGTTTCCTAGCGGAGTTTCCGAA
AATTGACGGGGAAAAGTTATGAAAATACTTGAATAATTGTGGAATATCTT
CATATTTTACATATATACATATCTACACATATCAACGACACTGCACTCAA
TAAAATGGGAAAGGATGGAGGGAATGTGAATAAAAAAAAAAAAAAAAA

AT11049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13405-RA 797 CG13405-RA 1..787 1..787 3935 100 Plus
CG13405.a 1361 CG13405.a 100..886 1..787 3935 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:01:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 74445..75225 781..1 3905 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:45:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:01:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 74480..75266 787..1 3935 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 74480..75266 787..1 3935 100 Minus
Blast to na_te.dros performed on 2019-03-16 00:01:06 has no hits.

AT11049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:02:16 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 74445..75225 1..781 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:59:34 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..573 57..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:57 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..573 57..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:37 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..573 57..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:50:19 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..573 57..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:55:03 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..573 57..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:36:40 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:57 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:37 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 5..785 1..781 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:50:19 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 1..781 1..781 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:55:03 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
CG13405-RA 5..785 1..781 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:16 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 74486..75266 1..781 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:16 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 74486..75266 1..781 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:02:16 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 74486..75266 1..781 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:37 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 74486..75266 1..781 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:22:12 Download gff for AT11049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 74486..75266 1..781 100   Minus

AT11049.hyp Sequence

Translation from 56 to 628

> AT11049.hyp
MSDVEQEASGDVDNEQNEGQEAAEDFEGEGEGDEQDVEEEDKFEVEEKDP
FELLNESDEDDEEQQAMYKEYQEVVNAIDAQNRIIKELKAKSNRLMFKKC
KTYRDKQEYKQLRVCQEHEEIHLKVLVNRAMHLQNFGSPRRYRDIEMEVT
EDEKSYFYTELQSTLSGFCPTDSADEYESDSESDNGLCCT*

AT11049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13405-PB 190 CG13405-PB 1..190 1..190 997 100 Plus
CG13405-PA 190 CG13405-PA 1..190 1..190 997 100 Plus
CG3213-PA 676 CG3213-PA 9..138 25..153 253 42.7 Plus

AT11049.pep Sequence

Translation from 56 to 628

> AT11049.pep
MSDVEQEASGDVDNEQNEGQEAAEDFEGEGEGDEQDVEEEDKFEVEEKDP
FELLNESDEDDEEQQAMYKEYQEVVNAIDAQNRIIKELKAKSNRLMFKKC
KTYRDKQEYKQLRVCQEHEEIHLKVLVNRAMHLQNFGSPRRYRDIEMEVT
EDEKSYFYTELQSTLSGFCPTDSADEYESDSESDNGLCCT*

AT11049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24900-PA 282 GF24900-PA 53..182 51..189 317 50.4 Plus
Dana\GF14666-PA 666 GF14666-PA 12..157 28..175 248 40.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14689-PA 191 GG14689-PA 1..191 1..190 711 80.6 Plus
Dere\GG24430-PA 679 GG24430-PA 35..172 49..189 237 39 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15998-PA 203 GH15998-PA 27..202 16..188 287 41.3 Plus
Dgri\GH13194-PA 674 GH13194-PA 2..165 28..179 239 37 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13405-PB 190 CG13405-PB 1..190 1..190 997 100 Plus
CG13405-PA 190 CG13405-PA 1..190 1..190 997 100 Plus
CG3213-PA 676 CG3213-PA 9..138 25..153 253 42.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16651-PA 195 GI16651-PA 44..168 47..171 272 43.2 Plus
Dmoj\GI17773-PA 678 GI17773-PA 5..137 29..153 242 42.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16091-PA 202 GL16091-PA 51..200 44..188 299 42.1 Plus
Dper\GL19472-PA 620 GL19472-PA 8..172 25..189 240 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28489-PA 218 GA28489-PA 73..216 50..188 283 41.1 Plus
Dpse\GA16698-PA 661 GA16698-PA 8..171 25..188 243 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14303-PA 188 GM14303-PA 1..188 1..190 837 92.6 Plus
Dsec\GM18141-PA 337 GM18141-PA 35..170 49..183 236 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13541-PA 190 GD13541-PA 1..190 1..190 805 93.7 Plus
Dsim\GD22749-PA 676 GD22749-PA 35..154 49..174 234 41.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17597-PA 677 GJ17597-PA 3..168 27..179 267 41.9 Plus
Dvir\GJ12904-PA 207 GJ12904-PA 47..201 47..188 248 39.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18914-PA 199 GK18914-PA 54..175 49..171 281 46 Plus
Dwil\GK14671-PA 664 GK14671-PA 32..140 44..153 259 47.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21050-PA 191 GE21050-PA 1..191 1..190 763 79.1 Plus
Dyak\GE14847-PA 677 GE14847-PA 35..172 49..189 237 39 Plus