Clone AT11120 Report

Search the DGRC for AT11120

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:111
Well:20
Vector:pOTB7
Associated Gene/TranscriptCG31870-RD
Protein status:AT11120.pep: gold
Sequenced Size:1081

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6508 2002-01-01 Sim4 clustering to Release 2
CG31870 2002-03-20 Blastp of sequenced clone
CG31870 2003-01-01 Sim4 clustering to Release 3
CG31870 2008-04-29 Release 5.5 accounting
CG31870 2008-08-15 Release 5.9 accounting
CG31870 2008-12-18 5.12 accounting

Clone Sequence Records

AT11120.complete Sequence

1081 bp (1081 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094652

> AT11120.complete
CCTCGTGCCGCTTTTTTGCTTCCCAAAAAATTTATTTGTTCTCCAAATCT
AAGATATTTAAATTAGTATTGTTGAAATTAGCCACAGCGAATAATTTGTG
AACATGTCTAGGAACTATGGACCTGGACCTGGAGCCTACATGCTACCCAG
CAGTTTTGGACAAAAAGGACCTCAGTTCTCCTTCGGCCGCAGAATTGACC
GCAAAAGAGATGAAAAACCTGGTCCGGGTCCTGCTGCTTATAAGGTGGAT
AAAGTGACACGCTACGGAAACGCGGAGGGTCCACAGTTTTCCATGTATGT
TAGGAACTCCAAGATGAAACCCCTCCCCATTCGATTGTCTTGAAGATTCG
ATCCTGATCCCGTATTTAGTAATCAAGTTTCTAAAACAGTCGATTTTGTG
ATCCGGTTGTCCACTCAATTCGCCCGCATTGCATTTCCAATTTGCTTCAA
TTAATGCCCAAGACATTGATGCACAATTTCCATTCAAATCGATGCCATGG
CAACGGGGATTGCTAATCGCCCTTAACTCGGCAATTAATTCGACGACACA
TTCAATTTGAATGGAGGTGGGTGATGGGCAATGGATGCACCAAATGCAAA
TCGGCGGCGGGGGTGGAGAATCGGGAAATGGTAATAATGACAGTCTGTGG
TAGCTGGTGGCATGAGAATTGATACACAATGCGGCGACAACCACTTGTTG
GACCTGTTGGAAGAGCCTTTGGTCAGGACACTTTACTTCTCATCACTTCA
GGACGAGGGCTTAGATGAGGGCACTTCAGCTGTTGGTCGGCTTTGTGAAT
GTGCCCGAGTGGACAGAAGGACTGGTGGCCTAAGTAACTCACTTTGCAGT
CCAGGCCAGTCGTCTACTGAGTGACTGAACCGCGCCAAAGGAGCAGCTTC
TGGCATCTAAGCGAAAGCCTGTTATTTTCCTCGCTGCCTGTAATAATCAC
ACAGTAAACAGGCAGCGGTCAGAAGACTTCACTGGGGTGGGGATGGCCTG
GATACACTGAGAAAAATGTCTGCTCTTTGTTACATTAAACAAATTACATG
CTAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

AT11120.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870.b 1318 CG31870.b 543..966 403..828 2000 98.3 Plus
CG31870.a 1319 CG31870.a 544..967 403..828 2000 98.3 Plus
CG31870.a 1319 CG31870.a 79..470 11..402 1900 98.9 Plus
CG31870.b 1318 CG31870.b 186..469 119..402 1360 98.5 Plus
CG31870-RC 536 CG31870-RC 186..469 119..402 1360 98.5 Plus
CG31870.b 1318 CG31870.b 985..1212 827..1054 1110 99.1 Plus
CG31870.a 1319 CG31870.a 986..1213 827..1054 1110 99.1 Plus
CG31870.b 1318 CG31870.b 67..175 11..119 545 100 Plus
CG31870-RC 536 CG31870-RC 67..175 11..119 545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10789541..10790200 403..1052 2740 94.6 Plus
chr2L 23010047 chr2L 10789184..10789467 119..402 1390 99.3 Plus
chr2L 23010047 chr2L 10789017..10789126 11..120 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:45:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10790783..10791452 403..1054 2855 95.7 Plus
2L 23513712 2L 10790426..10790709 119..402 1360 98.6 Plus
2L 23513712 2L 10790259..10790368 11..120 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10790783..10791206 403..828 2000 98.3 Plus
2L 23513712 2L 10790426..10790709 119..402 1360 98.5 Plus
2L 23513712 2L 10791225..10791452 827..1054 1110 99.1 Plus
2L 23513712 2L 10790259..10790368 11..120 550 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:37:51 has no hits.

AT11120.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:38:35 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10789017..10789125 11..119 100 -> Plus
chr2L 10789185..10789467 120..402 99 -> Plus
chr2L 10789541..10789952 403..824 96 -> Plus
chr2L 10789970..10790200 825..1052 96   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:59:38 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 1..240 104..343 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:53:59 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 1..240 104..343 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:58 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 1..240 104..343 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:36:30 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 1..240 104..343 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:15 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 1..240 104..343 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:06:33 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 18..409 11..402 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:53:59 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 18..409 11..402 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:58 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RD 38..857 11..835 98 -> Plus
CG31870-RD 880..1097 836..1052 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:36:30 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RA 18..409 11..402 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:15 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
CG31870-RD 38..857 11..835 98 -> Plus
CG31870-RD 880..1097 836..1052 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:35 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10790259..10790367 11..119 100 -> Plus
2L 10790427..10790709 120..402 98 -> Plus
2L 10790783..10791210 403..835 97 -> Plus
2L 10791233..10791450 836..1052 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:35 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10790259..10790367 11..119 100 -> Plus
2L 10790427..10790709 120..402 98 -> Plus
2L 10790783..10791210 403..835 97 -> Plus
2L 10791233..10791450 836..1052 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:35 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10790259..10790367 11..119 100 -> Plus
2L 10790427..10790709 120..402 98 -> Plus
2L 10790783..10791210 403..835 97 -> Plus
2L 10791233..10791450 836..1052 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:58 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10790259..10790367 11..119 100 -> Plus
arm_2L 10790427..10790709 120..402 98 -> Plus
arm_2L 10790783..10791210 403..835 97 -> Plus
arm_2L 10791233..10791450 836..1052 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:08 Download gff for AT11120.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10790427..10790709 120..402 98 -> Plus
2L 10790783..10791210 403..835 97 -> Plus
2L 10791233..10791450 836..1052 98   Plus
2L 10790259..10790367 11..119 100 -> Plus

AT11120.hyp Sequence

Translation from 103 to 342

> AT11120.hyp
MSRNYGPGPGAYMLPSSFGQKGPQFSFGRRIDRKRDEKPGPGPAAYKVDK
VTRYGNAEGPQFSMYVRNSKMKPLPIRLS*

AT11120.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870-PD 79 CG31870-PD 1..79 1..79 426 100 Plus
CG31870-PA 79 CG31870-PA 1..79 1..79 426 100 Plus
CG31870-PE 67 CG31870-PE 1..67 13..79 356 100 Plus
CG31870-PC 67 CG31870-PC 1..67 13..79 356 100 Plus
CG10252-PA 229 CG10252-PA 4..77 3..69 179 52 Plus

AT11120.pep Sequence

Translation from 103 to 342

> AT11120.pep
MSRNYGPGPGAYMLPSSFGQKGPQFSFGRRIDRKRDEKPGPGPAAYKVDK
VTRYGNAEGPQFSMYVRNSKMKPLPIRLS*

AT11120.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15827-PA 79 GF15827-PA 1..77 1..77 291 75.3 Plus
Dana\GF18749-PA 225 GF18749-PA 5..78 3..69 151 49.3 Plus
Dana\GF18747-PA 90 GF18747-PA 5..79 3..65 127 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23676-PA 79 GG23676-PA 1..79 1..79 383 94.9 Plus
Dere\GG12416-PA 229 GG12416-PA 4..79 3..71 162 50.6 Plus
Dere\GG12414-PA 80 GG12414-PA 3..79 1..67 157 48.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13587-PA 81 GH13587-PA 6..81 6..79 185 52.6 Plus
Dgri\GH13919-PA 229 GH13919-PA 4..72 3..64 147 51.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31870-PD 79 CG31870-PD 1..79 1..79 426 100 Plus
CG31870-PA 79 CG31870-PA 1..79 1..79 426 100 Plus
CG31870-PE 67 CG31870-PE 1..67 13..79 356 100 Plus
CG31870-PC 67 CG31870-PC 1..67 13..79 356 100 Plus
CG10252-PA 229 CG10252-PA 4..77 3..69 179 52 Plus
CG31468-PB 80 CG31468-PB 4..79 2..67 167 48.7 Plus
CG31468-PA 80 CG31468-PA 4..79 2..67 167 48.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes154-PA 229 GI24832-PA 7..72 6..64 138 47.8 Plus
Dmoj\GI24833-PA 229 GI24833-PA 7..72 6..64 134 47.8 Plus
Dmoj\GI23538-PA 61 GI23538-PA 2..60 20..78 131 44.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26636-PA 71 GL26636-PA 1..67 13..77 164 54.4 Plus
Dper\GL13835-PA 229 GL13835-PA 4..72 3..64 132 47.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16539-PA 71 GA16539-PA 1..67 13..77 161 54.4 Plus
Dpse\GA26812-PA 229 GA26812-PA 4..72 3..64 132 47.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18739-PA 79 GM18739-PA 1..79 1..79 394 98.7 Plus
Dsec\GM23550-PA 229 GM23550-PA 4..79 3..71 161 50.6 Plus
Dsec\GM23548-PA 81 GM23548-PA 3..80 1..67 150 47.4 Plus
Dsec\GM18736-PA 81 GM18736-PA 3..80 1..67 150 47.4 Plus
Dsec\GM26710-PA 81 GM26710-PA 3..80 1..67 150 47.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23733-PA 79 GD23733-PA 1..79 1..79 388 96.2 Plus
Dsim\GD18365-PA 229 GD18365-PA 4..79 3..71 161 50.6 Plus
Dsim\GD18362-PA 81 GD18362-PA 3..80 1..67 154 48.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20745-PA 87 GJ20745-PA 1..85 1..77 176 47.1 Plus
Dvir\GJ24476-PA 225 GJ24476-PA 3..68 6..64 144 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14096-PA 229 GK14096-PA 4..79 3..71 149 46.8 Plus
Dwil\GK14097-PA 229 GK14097-PA 4..76 3..68 136 48.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18489-PA 79 GE18489-PA 1..79 1..79 386 94.9 Plus
Dyak\GE23935-PA 229 GE23935-PA 4..79 3..71 162 50.6 Plus
Dyak\GE23933-PA 81 GE23933-PA 3..81 1..68 159 44.3 Plus