Clone AT11343 Report

Search the DGRC for AT11343

Clone and Library Details

Library:AT
Tissue Source:Drosophila melanogaster adult testes
Created by:Ling Hong
Date Registered:2000-06-08
Comments:Oligo dT-primed and directionally cloned at EcoRI and XhoI in pOTB7
Original Plate Number:113
Well:43
Vector:pOTB7
Associated Gene/TranscriptCG32022-RA
Protein status:AT11343.pep: gold
Preliminary Size:1557
Sequenced Size:741

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5950 2002-01-01 Sim4 clustering to Release 2
CG32022 2002-02-22 Blastp of sequenced clone
CG32022 2003-01-01 Sim4 clustering to Release 3
CG32022 2008-04-29 Release 5.5 accounting
CG32022 2008-08-15 Release 5.9 accounting
CG32022 2008-12-18 5.12 accounting

Clone Sequence Records

AT11343.complete Sequence

741 bp (741 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089312

> AT11343.complete
TGAATACAAATCTGACACAAAAGCATGACACTGTTTGCCCTCATCGCCCT
GCTCAGCCTGCTGAACACAATCCTGCCAGATTTCATAAGGAACTACCTCA
AAGTGTCGCGGTTGTGGGGCGTAAGGAACTCCGCGGAAATTCGGCAGTTG
CAGACAGAACTGGACGATGCCCGGAAGCAAGTGGAGGTGGTCAGCAATGC
GGAGCATTCCGGAGAGTACGCCAGGACCATCAAAATTATGCGCGCCGAGC
GTAAAGTATCAGAGGCGGAGGCGAAACTGAAATCTGCCCGGGGAATGGAG
AACTTCATGCGGATAAGCATCGATACGGCCATGTTCTACGGATCTAAGGT
GCTGCTCTCAGCAATAACCGTGTTTATCAGCATCCGGAATCGTGGAACGC
CCGTCATGATCATCGATGAAGCGATCAGCCTGGCTCCGTTCACAGGACTT
CTTAGTTTTCCTACTGGCGTGGCCAATGCCATTTCGGTGCCCGCCTGGGC
ATTCTCCTGCAACCTGACATTTCGACTCATCTACGGCTTTGTGAAAAATC
GTGGGGCGTGATTCCATCCGAGCGAAATCCCTCCATTTCATTTAGCACTT
AGAAGGCGCTCGAAACTATGTACTTTGTTATGGTTTGCTAAGCTTCATCA
TGCATTGACTCTTGAATGTAAAGGCCCAATTTTATGTAAGCACCACATCA
AATAAATGTATTTTCAGACAAGAAAAAAAAAAAAAAAAAAA

AT11343.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG32022-RA 956 CG32022-RA 217..939 1..723 3615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8712309..8712934 722..97 3115 99.8 Minus
chr3L 24539361 chr3L 8712990..8713085 96..1 480 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 15:45:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8720279..8720905 723..97 3135 100 Minus
3L 28110227 3L 8720961..8721056 96..1 480 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:15:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8713379..8714005 723..97 3135 100 Minus
3L 28103327 3L 8714061..8714156 96..1 480 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:22:50 has no hits.

AT11343.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:23:50 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8712309..8712934 97..722 99 <- Minus
chr3L 8712990..8713085 1..96 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 14:59:56 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 1..537 25..561 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:54:30 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 1..537 25..561 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:40:09 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 1..537 25..561 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:37:00 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 1..537 25..561 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:31:47 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 1..537 25..561 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:07:23 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 217..938 1..722 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:54:30 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 217..938 1..722 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:40:09 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 71..792 1..722 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:37:00 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 217..938 1..722 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:31:47 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
CG32022-RA 71..792 1..722 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:50 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8720280..8720905 97..722 100 <- Minus
3L 8720961..8721056 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:50 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8720280..8720905 97..722 100 <- Minus
3L 8720961..8721056 1..96 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:23:50 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8720280..8720905 97..722 100 <- Minus
3L 8720961..8721056 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:40:09 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8713380..8714005 97..722 100 <- Minus
arm_3L 8714061..8714156 1..96 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:19:46 Download gff for AT11343.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8713380..8714005 97..722 100 <- Minus
3L 8714061..8714156 1..96 100   Minus

AT11343.pep Sequence

Translation from 24 to 560

> AT11343.pep
MTLFALIALLSLLNTILPDFIRNYLKVSRLWGVRNSAEIRQLQTELDDAR
KQVEVVSNAEHSGEYARTIKIMRAERKVSEAEAKLKSARGMENFMRISID
TAMFYGSKVLLSAITVFISIRNRGTPVMIIDEAISLAPFTGLLSFPTGVA
NAISVPAWAFSCNLTFRLIYGFVKNRGA*

AT11343.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10150-PA 178 GF10150-PA 1..178 1..178 767 81.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15063-PA 178 GG15063-PA 1..178 1..178 862 91.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22511-PA 175 GH22511-PA 1..175 1..176 542 58 Plus
Dgri\GH16143-PA 175 GH16143-PA 1..175 1..176 542 58 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG32022-PB 178 CG32022-PB 1..178 1..178 879 100 Plus
CG32022-PA 178 CG32022-PA 1..178 1..178 879 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12412-PA 173 GI12412-PA 1..173 1..175 503 55.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10288-PA 177 GL10288-PA 13..177 13..178 552 63.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16616-PA 177 GA16616-PA 13..177 13..178 552 63.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24920-PA 178 GM24920-PA 1..178 1..178 917 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:08:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12966-PA 178 GD12966-PA 1..178 1..178 917 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12304-PA 173 GJ12304-PA 1..173 1..175 564 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17472-PA 177 GK17472-PA 1..177 1..178 585 61.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:08:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21286-PA 178 GE21286-PA 1..178 1..178 900 96.1 Plus

AT11343.hyp Sequence

Translation from 24 to 560

> AT11343.hyp
MTLFALIALLSLLNTILPDFIRNYLKVSRLWGVRNSAEIRQLQTELDDAR
KQVEVVSNAEHSGEYARTIKIMRAERKVSEAEAKLKSARGMENFMRISID
TAMFYGSKVLLSAITVFISIRNRGTPVMIIDEAISLAPFTGLLSFPTGVA
NAISVPAWAFSCNLTFRLIYGFVKNRGA*

AT11343.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG32022-PB 178 CG32022-PB 1..178 1..178 879 100 Plus
CG32022-PA 178 CG32022-PA 1..178 1..178 879 100 Plus